y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi006147m
FamilyGH79
Protein PropertiesLength: 573 Molecular Weight: 60910.5 Isoelectric Point: 9.7564
ChromosomeChromosome/Scaffold: 4 Start: 3999683 End: 4002907
Descriptionglucuronidase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79495650
  EDFVCATLDWWPPDKCDYGTCAWGRAGLLNLDLSNKVLLNAIRAFSPLKLRLGGSLQDKVVYGTADLGRPCTPFVKNASQMLGFTQGCLPLRRWDELNAF
  FQKSGAKVVFGLNALNGRVPLPDGSMGGPWDYTNAASLIRYTAYKGYQIHGWELGNELSGSGVGTRIGAGQYAADVIALRRIVDDIYRSNPSKPLVLAPG
  GFFEPGWFTELIVKTKPNLLNVITHHIYNLGPGRDTHLIEKILDPSVLDGMISTFSNLQGILKSTGTSTVAWVGEAGGAYNSGHHLVTDAFVFSFWFLDQ
  LGMSAKYDTKSYCRQSLIGGNYGLLNTTTFQPNPDYYSALLWHRLMGTKVLATTFTGTNKIRAYAHCARDSPGITLLLINLSGNTKTQVSVTQTAAVAGG
  AHNHGARRSNTTTQVSVTTQAAAAGEHKHGWRRHGRKFGHSHAPGLAAAAAAGATRDEYHLTPKGGDLRSQVMLLNGRALATGADGSIPRLEPVKVGAAE
  PIAVAPYSIVFARIPHF
Full Sequence
Protein Sequence     Length: 573     Download
MVAAGLRLLG VVWIFATLMP LGAAAAGAAG GHAAVAAVDG RRAVAATGED FVCATLDWWP    60
PDKCDYGTCA WGRAGLLNLD LSNKVLLNAI RAFSPLKLRL GGSLQDKVVY GTADLGRPCT    120
PFVKNASQML GFTQGCLPLR RWDELNAFFQ KSGAKVVFGL NALNGRVPLP DGSMGGPWDY    180
TNAASLIRYT AYKGYQIHGW ELGNELSGSG VGTRIGAGQY AADVIALRRI VDDIYRSNPS    240
KPLVLAPGGF FEPGWFTELI VKTKPNLLNV ITHHIYNLGP GRDTHLIEKI LDPSVLDGMI    300
STFSNLQGIL KSTGTSTVAW VGEAGGAYNS GHHLVTDAFV FSFWFLDQLG MSAKYDTKSY    360
CRQSLIGGNY GLLNTTTFQP NPDYYSALLW HRLMGTKVLA TTFTGTNKIR AYAHCARDSP    420
GITLLLINLS GNTKTQVSVT QTAAVAGGAH NHGARRSNTT TQVSVTTQAA AAGEHKHGWR    480
RHGRKFGHSH APGLAAAAAA GATRDEYHLT PKGGDLRSQV MLLNGRALAT GADGSIPRLE    540
PVKVGAAEPI AVAPYSIVFA RIPHFNAPAC RS*                                 600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03662Glyco_hydro_79n047350304+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACF81144.103957035542unknown [Zea mays]
GenBankEAY99897.1075705524hypothetical protein OsI_21892 [Oryza sativa Indica Group]
GenBankEAZ36024.1075705524hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
RefSeqNP_001132339.103957035542hypothetical protein LOC100193781 [Zea mays]
RefSeqXP_002437942.1015701553hypothetical protein SORBIDRAFT_10g005260 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vo0_A0.0000002143464122433A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3vnz_A0.0000002143464122433A Chain A, Plant Carboxylesterase Aecxe1 From Actinidia Eriantha With Acyl Adduct
PDB3vny_A0.0000002143464122433A Chain A, Crystal Structure Of Beta-Glucuronidase From Acidobacterium Capsulatum
Transmembrane Domains
StartEnd
931
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CB6539512541213740
EG3826632721714420
CB652591255893430
FL7905282352064400
GO8731563511935430
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2
Glyma06g21551.1Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2
Glyma02g12740.2Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi016855mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)