y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi006161m
FamilyGT2
Protein PropertiesLength: 562 Molecular Weight: 62272.2 Isoelectric Point: 8.1753
ChromosomeChromosome/Scaffold: 4 Start: 8718319 End: 8721240
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT21323055.3e-31
  QIPMYNEREVYKLSIGAACRLAWPSDRVIVQVLDDSTDPTIKDLVELECKFWANKGKNVKYEVRNNRKGYKAGALKQGMLYDYVQQCDFVAVFDADFQPE
  PDFLVRTVPYLVHNPRIALVQARWEFVNPNEFLMTRIQKMTLDYHFKVEQEAGSSTFAFFGFNGTAGVWRISSI
Full Sequence
Protein Sequence     Length: 562     Download
MAGAPAGASL AAVAAGWLDL DGSTSTTATT LLLRRWWWPP LPPSGAAEAL RAAWDVARAA    60
AVAPALAAAS WACLALSAML LADAVFLAAA SLLAPRGRYR AAGPAAAAEE DGDEEASGRA    120
VGGGGYPMVL IQIPMYNERE VYKLSIGAAC RLAWPSDRVI VQVLDDSTDP TIKDLVELEC    180
KFWANKGKNV KYEVRNNRKG YKAGALKQGM LYDYVQQCDF VAVFDADFQP EPDFLVRTVP    240
YLVHNPRIAL VQARWEFVNP NEFLMTRIQK MTLDYHFKVE QEAGSSTFAF FGFNGTAGVW    300
RISSIKEAGG WEDRTTVEDM DLAVRAGLKG WKFIYVGDVK VKSELPSNLK AYRRQQHRWT    360
CGAANLFRKT GAEIILTKEV SLWRKLYLIY SFFFIRKVVA HVVPFMLYCV VIPLSVLIPE    420
VTVPVWGVVY IPTTITLLYA IRNPSSLHFI PFWILFENVM SFHRTKAAVI GLLELGSVNE    480
WVVTEKLGNS SCTKPVPQIL EKPPCRSWDR CTMSEILVAI FLFFCATYNL VYGGDFYFVY    540
IYLQAITFLI VGTGFCGTSN S*                                             600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd06423CESA_like2.0e-24131319190+
cd06435CESA_NdvC_like5.0e-29131369240+
COG1215COG12157.0e-31125484362+
cd06421CESA_CelA_like2.0e-38127367244+
cd06437CESA_CaSu_A28.0e-120127362236+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN62185.104555816524hypothetical protein [Vitis vinifera]
Swiss-ProtQ67VS704855810523CSLA9_ORYSJ RecName: Full=Probable mannan synthase 9; AltName: Full=Cellulose synthase-like protein A9; AltName: Full=OsCslA9
Swiss-ProtQ67X4507956167549CSLA3_ORYSJ RecName: Full=Probable mannan synthase 3; AltName: Full=Cellulose synthase-like protein A3; AltName: Full=OsCslA3
Swiss-ProtQ8S7W006456037546CSLA4_ORYSJ RecName: Full=Probable mannan synthase 4; AltName: Full=Cellulose synthase-like protein A4; AltName: Full=OsCslA4
RefSeqXP_002315357.105455826525predicted protein [Populus trichocarpa]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hg6_A2e-20127400140443B Chain B, Structure Of A Cellulose Synthase - Cellulose Translocation Intermediate
Transmembrane Domains
StartEnd
6890
398417
422441
516533
537559
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7948664501215580
JG8921962832765580
CF5116933221534740
JK5603692472605060
DY3658582951244180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_004_00030.2Aquca_004_00030.1Aquca_058_00217.3Aquca_058_00217.2Aquca_058_00217.1
Aquca_002_00287.1Aquca_017_00107.1Aquca_083_00103.2Aquca_083_00103.1Aquca_019_00047.2
Aquca_019_00047.1Aquca_030_00077.1Aquca_009_00991.3Aquca_009_00991.2Aquca_009_00991.1
Aquca_019_00048.1Aquca_030_00077.2Aquca_009_00991.4
Arabidopsis lyrata491580901017484602478055489694
487155482526489123883535907034
889889915064488470313253874206
Arabidopsis thalianaAT4G31590.1AT2G24630.1AT3G28180.1AT3G07330.1AT4G07960.1
AT5G03760.1AT2G35650.1AT5G22740.1AT4G13410.1AT5G16190.1
AT1G23480.3AT1G23480.2AT1G23480.1AT3G56000.1AT1G24070.1
AT4G16590.1
Brachypodium distachyonBradi3g19087.1Bradi1g07277.1Bradi1g57552.1Bradi2g50967.1Bradi2g20141.2
Bradi2g20141.1Bradi3g59447.1Bradi3g36697.1Bradi1g20500.1Bradi4g38970.1
Bradi3g06740.2Bradi3g06740.1Bradi3g25658.1Bradi1g35647.1
Brassica rapaBra011284Bra007838Bra025323Bra039061Bra001246
Bra000635Bra023993Bra005779Bra009512Bra020212
Bra023020Bra002426Bra006633Bra012416Bra024603
Bra008638Bra012702Bra007207Bra006343Bra017305
Bra032705
Carica papayaevm.model.supercontig_23.38evm.model.supercontig_286.3evm.model.supercontig_160.31evm.model.supercontig_8.105evm.model.supercontig_5.88
evm.model.supercontig_720.2evm.model.supercontig_47.50
Capsella rubellaCarubv10004278mCarubv10022768mCarubv10016783mCarubv10013120mCarubv10000367m
Carubv10000681mCarubv10000683mCarubv10004510mCarubv10000762mCarubv10004546m
Carubv10008745mCarubv10025026mCarubv10008757mCarubv10019203m
Chlamydomonas reinhardtiig6025.t2g6025.t1
Citrus clementinaCiclev10007641mCiclev10014531mCiclev10030861mCiclev10000437mCiclev10013685m
Ciclev10031284mCiclev10011455mCiclev10028164m
Citrus sinensisorange1.1g005507morange1.1g006104morange1.1g041566morange1.1g011596morange1.1g005700m
orange1.1g009761morange1.1g044519morange1.1g041333m
Cucumis sativusCucsa.311130.1Cucsa.158900.1Cucsa.387710.1Cucsa.353070.1Cucsa.395390.1
Cucsa.163310.2Cucsa.163310.1Cucsa.385420.7Cucsa.385420.4Cucsa.385420.1
Cucsa.083070.1Cucsa.083080.1Cucsa.378620.1
Eucalyptus grandisEucgr.C02007.1Eucgr.I01833.1Eucgr.F02219.1Eucgr.F00101.1Eucgr.H00749.1
Eucgr.F04010.1Eucgr.G02715.1Eucgr.A01558.2Eucgr.A01558.1Eucgr.J00420.1
Eucgr.A01558.3
Fragaria vescamrna08735.1-v1.0-hybridmrna05685.1-v1.0-hybridmrna17431.1-v1.0-hybridmrna28359.1-v1.0-hybridmrna26403.1-v1.0-hybrid
mrna02631.1-v1.0-hybridmrna14456.1-v1.0-hybridmrna30129.1-v1.0-hybridmrna23579.1-v1.0-hybrid
Glycine maxGlyma08g23820.1Glyma04g08100.1Glyma14g18140.1Glyma07g00590.1Glyma06g08180.1
Glyma17g29060.1Glyma13g04480.1Glyma16g10680.1Glyma03g21730.1Glyma19g01560.1
Glyma14g10230.1Glyma06g05190.1Glyma04g05100.1Glyma19g37480.2Glyma19g37480.1
Glyma03g34800.1Glyma19g36810.1Glyma10g34550.1Glyma20g32990.1Glyma10g07560.1
Glyma13g21440.1Glyma03g34060.1Glyma17g05350.1Glyma11g19490.1Glyma12g08990.1
Glyma10g34550.2
Gossypium raimondiiGorai.001G040500.1Gorai.009G066500.1Gorai.010G120900.1Gorai.006G028400.1Gorai.N005100.8
Gorai.N005100.7Gorai.N005100.6Gorai.N005100.5Gorai.N005100.4Gorai.N005100.1
Gorai.005G098600.2Gorai.005G098600.1Gorai.010G028300.3Gorai.010G028300.2Gorai.010G028300.1
Gorai.009G222300.1Gorai.009G277600.1Gorai.006G028400.2Gorai.011G232100.1Gorai.002G243400.2
Gorai.002G243400.1Gorai.009G305600.1Gorai.006G109100.6Gorai.006G109100.4Gorai.006G109100.3
Gorai.006G109100.2Gorai.006G109100.1Gorai.004G008100.1Gorai.006G109100.7Gorai.006G109100.5
Gorai.004G008100.2
Linum usitatissimumLus10026923Lus10020120Lus10039440Lus10039475Lus10038217
Lus10025886Lus10007715Lus10018651Lus10008646Lus10035580
Lus10009387Lus10020539
Malus domesticaMDP0000270189MDP0000201865MDP0000174127MDP0000286908MDP0000295826
MDP0000183140MDP0000264823MDP0000300397MDP0000130989MDP0000572242
MDP0000215777MDP0000139721MDP0000297462MDP0000717000MDP0000263736
MDP0000233405MDP0000307919MDP0000133719MDP0000230967MDP0000210684
MDP0000712023
Manihot esculentacassava4.1_002818mcassava4.1_003168mcassava4.1_003164mcassava4.1_003038mcassava4.1_003026m
cassava4.1_002707mcassava4.1_002727mcassava4.1_005319mcassava4.1_025352mcassava4.1_005126m
cassava4.1_005132m
Medicago truncatulaMedtr3g109040.1Medtr4g006010.1Medtr8g012320.1Medtr1g061510.1Medtr4g055520.2
Medtr4g055520.1Medtr4g055520.3
Mimulus guttatusmgv1a004672mmgv1a002241mmgv1a003162mmgv1a002316mmgv1a002362m
mgv1a026509mmgv1a017694mmgv1a023425mmgv1a004346mmgv1a004073m
mgv1a004186mmgv1a004240mmgv1a004482m
Oryza sativaLOC_Os09g25900.1LOC_Os08g15420.1LOC_Os03g56060.1LOC_Os07g03260.1LOC_Os01g56130.1
LOC_Os05g43530.1LOC_Os06g42020.1LOC_Os02g51060.1LOC_Os07g43710.1LOC_Os03g26044.1
LOC_Os03g07350.1LOC_Os02g09930.2LOC_Os02g09930.1LOC_Os08g33740.1LOC_Os10g26630.1
LOC_Os06g12460.1LOC_Os09g26770.3LOC_Os09g26770.2
Panicum virgatumPavirv00057615mPavirv00060038mPavirv00017495mPavirv00029970mPavirv00058766m
Pavirv00058702mPavirv00035780mPavirv00052315mPavirv00014001mPavirv00046697m
Pavirv00037606mPavirv00039936mPavirv00009713mPavirv00050985mPavirv00050984m
Pavirv00049797mPavirv00049796mPavirv00022626mPavirv00054691mPavirv00036002m
Pavirv00060323mPavirv00013640mPavirv00029891mPavirv00059726mPavirv00017665m
Pavirv00001702mPavirv00036247mPavirv00035687m
Physcomitrella patensPp1s162_130V6.1Pp1s224_44V6.1Pp1s89_286V6.1Pp1s19_258V6.1Pp1s373_28V6.1
Pp1s164_5V6.1Pp1s15_115V6.1Pp1s65_194V6.1Pp1s36_214V6.1Pp1s36_62V6.1
Pp1s372_55V6.1
Phaseolus vulgarisPhvul.008G255800.1Phvul.009G102200.1Phvul.004G019600.1Phvul.010G024700.1Phvul.009G074400.1
Phvul.007G105400.1Phvul.001G185800.1Phvul.007G223800.1Phvul.011G089900.1
Picea abiesMA_10429365g0010MA_10431741g0020MA_712121g0010MA_96942g0010MA_159111g0350.427.597
Populus trichocarpaPotri.018G009300.1Potri.006G270900.1Potri.014G190900.1Potri.002G248400.2Potri.002G248400.1
Potri.005G146900.1Potri.002G114200.1Potri.008G026400.1Potri.006G116900.4Potri.006G116900.3
Potri.006G116900.2Potri.006G116900.1Potri.004G189000.1Potri.009G149700.5Potri.009G149700.3
Potri.009G149700.2Potri.009G149700.1Potri.010G234100.1Potri.006G116900.5Potri.009G149700.4
Prunus persicappa002254mppa002275mppa002511mppa002311mppa002209m
ppa024741mppa004315mppa004330mppa003918mppa004037m
Ricinus communis29848.m00447729822.m00338530170.m01366029991.m00063829092.m000444
29428.m000330
Setaria italicaSi013296mSi032804mSi000541mSi035399mSi034503m
Si021376mSi029148mSi016839mSi029676mSi016912m
Si035101mSi034919mSi035204mSi032179mSi008033m
Si015800m
Selaginella moellendorffii140200442658230176432432412258
448970432624.675.844432624.675.844431149
Sorghum bicolorSb01g006820.1Sb09g025260.1Sb02g002090.1Sb07g007890.1Sb07g021300.1
Sb02g040200.1Sb04g028070.1Sb01g045850.1Sb04g006260.1Sb02g012870.1
Sb10g024640.1
Thellungiella halophilaThhalv10024573mThhalv10000073mThhalv10003763mThhalv10020204mThhalv10028486m
Thhalv10028476mThhalv10028475mThhalv10013220mThhalv10013221mThhalv10007266m
Thhalv10025412mThhalv10024828mThhalv10013578mThhalv10007269mThhalv10005891m
Thhalv10016754m
Vitis viniferaGSVIVT01033168001GSVIVT01016135001GSVIVT01032523001GSVIVT01009290001GSVIVT01002010001
GSVIVT01033767001GSVIVT01034719001GSVIVT01025737001GSVIVT01031405001
Volvox carteriVocar20003015m
Zea maysAC183932.3_FGT007
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)