Basic Information | |
---|---|
Species | Setaria italica |
Cazyme ID | Si012108m |
Family | CBM43 |
Protein Properties | Length: 96 Molecular Weight: 10249.6 Isoelectric Point: 8.0873 |
Chromosome | Chromosome/Scaffold: 7 Start: 22786247 End: 22786645 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 12 | 92 | 1.1e-30 |
WCIAKPSASNEILAQNLDYACSQVSCTVIQKGGPCYYPDSLVSRAAVAMNLYYASRGRNPWNCYFNSSALVVQSDPSYGSC |
Full Sequence |
---|
Protein Sequence Length: 96 Download |
GIVGVAAAQK TWCIAKPSAS NEILAQNLDY ACSQVSCTVI QKGGPCYYPD SLVSRAAVAM 60 NLYYASRGRN PWNCYFNSSA LVVQSDPSYG SCTYY* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 6.0e-15 | 11 | 80 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 3.0e-30 | 11 | 94 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG26564.1 | 0 | 5 | 95 | 69 | 159 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG36169.1 | 0 | 3 | 95 | 17 | 109 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
GenBank | ACG39487.1 | 0 | 3 | 95 | 30 | 122 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | XP_002446660.1 | 0 | 3 | 95 | 30 | 122 | hypothetical protein SORBIDRAFT_06g020000 [Sorghum bicolor] |
RefSeq | XP_002454863.1 | 0 | 3 | 95 | 31 | 123 | hypothetical protein SORBIDRAFT_03g000270 [Sorghum bicolor] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 6e-24 | 8 | 94 | 9 | 96 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
BE917786 | 94 | 3 | 96 | 0 |
BE357637 | 94 | 3 | 96 | 0 |
CA260775 | 94 | 3 | 96 | 0 |
FL297364 | 94 | 2 | 95 | 0 |
FL297338 | 94 | 2 | 95 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |