CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi016350m
FamilyGH13
Protein PropertiesLength: 798 Molecular Weight: 90486.4 Isoelectric Point: 6.0779
ChromosomeChromosome/Scaffold: 1 Start: 25750573 End: 25760537
Descriptionstarch branching enzyme 2.2
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133006205.3e-33
  LPRIKKLGYNAVQIMAIQEHSYYGSFGYHVTNFFAPSSRFGTPEDLKSLIDKAHELGLLVLMDVVHSHASSNTLDGLNGFDGTDTHYFHSGPRGHHWMWD
  SRLFNYGNWEVIRFLLSNARWWLEEYKFDGFRFDGVTSMMYTHHGLQVTFTGNFNEYFGFATDVDAVVYLMLVNDLIHGLYPEAVTIGEDVSGMPTFALP
  VHDGGVGFDYRLHMAVADKWIELMKQSDESWKMADIVHTLTNRRWLEKCVTYSESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPTIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 798     Download
MGTFVVPRGA PVGGGSRRRG AMRAAAASGK VVVPEGENDG LTSSADSAQF QSDELEVPDI    60
TEDQIESSET MHVAREADAQ ALNREVLGSA PQVKPRTVPP PGDGQKIFQI DSMLQGYKYH    120
LEYRYSLYRR IRSDIDEHEG GLEAFSRSYE KFGFNRSAEG VTYREWAPGA HSAALVGDFN    180
NWDPNADRMS KNEFGVWEVF LPNNADGSSP IPHGSRVKVR MDTPSGIKDS IPAWIRYSVQ    240
APGAIPYDGI YYDPPEEVKH VFKHPQPKRP KSLRIYETHV GMSSPEPKIN TYANFRDEVL    300
PRIKKLGYNA VQIMAIQEHS YYGSFGYHVT NFFAPSSRFG TPEDLKSLID KAHELGLLVL    360
MDVVHSHASS NTLDGLNGFD GTDTHYFHSG PRGHHWMWDS RLFNYGNWEV IRFLLSNARW    420
WLEEYKFDGF RFDGVTSMMY THHGLQVTFT GNFNEYFGFA TDVDAVVYLM LVNDLIHGLY    480
PEAVTIGEDV SGMPTFALPV HDGGVGFDYR LHMAVADKWI ELMKQSDESW KMADIVHTLT    540
NRRWLEKCVT YSESHDQALV GDKTIAFWLM DKDMYDFMAL DRPSTPTIDR GIALHKMIRL    600
ITMGLGGEGY LNFMGNEFGH PEWIDFPRGP QRLPSGKFIP GNNNSYDKCR RRFDLGDADY    660
LRYHGMQEFD RAMQHLEEKY GFMTDDHQYI SRKHEEDKVI VFEKGDLVFV FNFHCNNSYF    720
DYRVGCRRSG VYKVVLDSDA GLFGGFGRIH HTAEHFTDGS HDNRPHSFSV YTPSRTCVVY    780
APADTIVPES SEEVISK* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029602.0e-812120187+
PLN03244PLN032442.0e-136211780577+
PLN02447PLN02447030792768+
cd11321AmyAc_bac_euk_BE0255671418+
PLN02960PLN029600211780576+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB33385.10327841738branching enzyme II BEII [Zea mays, cultivar B73, endosperms, Peptide, 738 aa]
GenBankAAC33764.10478434799starch branching enzyme IIb [Zea mays]
GenBankAAP72267.10978442803starch branching enzyme IIb [Sorghum bicolor]
RefSeqNP_001105316.10478434799amylose extender1 precursor [Zea mays]
RefSeqXP_002453926.10978442803hypothetical protein SORBIDRAFT_04g021540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0977843694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3aml_A0977843694A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0977843694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0977843694A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB1m7x_D01477789610A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366951017940
HO7776386391577940
HO4581233983907860
HO458123296953890
HO777638471101560.00006
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686m
cassava4.1_002337mcassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598m
cassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi009379mSi009312mSi005911mSi006006m
Si006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)