y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi016855m
FamilyGH79
Protein PropertiesLength: 539 Molecular Weight: 58262.8 Isoelectric Point: 6.317
ChromosomeChromosome/Scaffold: 1 Start: 40621802 End: 40625573
Descriptionglucuronidase 3
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH79495320
  DDDFVCATLDWWPPDKCDYGTCSWGRASLLNLNLSNKILLNAVKAFSPLKLRLGGSLQDMLIYDTGDSHQSCTPFVKNTSAMFGFSQGCLPLNRWDELNA
  FFQKSGAKIIFGLNALNGRVPMPDGSLGGPWNYTNAASFIRYAVNKGYDIHGWELGNELSGSGVGARIDADQYAADVITLKQIIDSTYQGNPSKPLVLAP
  GGFFDAAWFTELVSKTKPSQMDVITHHIYNLGPGVDDHLIEKILNPSYLDGEASTFSNLQGILKSAGTSTVAWVGEAGGAYNSGHHLVTDAFVFSFWYLD
  QLGMSSKYDTKSYCRQTLVGGNYGLLNKTTFEPNPDYYSALLWHRLMGTKVLSTTFNGTNKIRTYAHCARNSEGITLLLINLSGNNTNHIYVASEGARTQ
  SARKENRRFGHIPGLGEAAELTREEYHLTPKDGNLQSQQVLLNGNVLATDANGDIPKLEPVQVEGTQPITVGPYSIVFAHIPSF
Full Sequence
Protein Sequence     Length: 539     Download
MAAGLLLKMV GFCVWALFWL GGTATVSTTA LAGGDAVVVD ARSAVAATDD DFVCATLDWW    60
PPDKCDYGTC SWGRASLLNL NLSNKILLNA VKAFSPLKLR LGGSLQDMLI YDTGDSHQSC    120
TPFVKNTSAM FGFSQGCLPL NRWDELNAFF QKSGAKIIFG LNALNGRVPM PDGSLGGPWN    180
YTNAASFIRY AVNKGYDIHG WELGNELSGS GVGARIDADQ YAADVITLKQ IIDSTYQGNP    240
SKPLVLAPGG FFDAAWFTEL VSKTKPSQMD VITHHIYNLG PGVDDHLIEK ILNPSYLDGE    300
ASTFSNLQGI LKSAGTSTVA WVGEAGGAYN SGHHLVTDAF VFSFWYLDQL GMSSKYDTKS    360
YCRQTLVGGN YGLLNKTTFE PNPDYYSALL WHRLMGTKVL STTFNGTNKI RTYAHCARNS    420
EGITLLLINL SGNNTNHIYV ASEGARTQSA RKENRRFGHI PGLGEAAELT REEYHLTPKD    480
GNLQSQQVLL NGNVLATDAN GDIPKLEPVQ VEGTQPITVG PYSIVFAHIP SFYAPACS*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12876Cellulase-like0.00119527791+
pfam03662Glyco_hydro_79n052351300+
Gene Ontology
GO TermDescription
GO:0016020membrane
GO:0016798hydrolase activity, acting on glycosyl bonds
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankEAY87898.1015371540hypothetical protein OsI_09318 [Oryza sativa Indica Group]
GenBankEAY99897.10115389525hypothetical protein OsI_21892 [Oryza sativa Indica Group]
GenBankEAZ36024.10115389525hypothetical protein OsJ_20330 [Oryza sativa Japonica Group]
RefSeqNP_001048420.1015371540Os02g0802200 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002452991.1015381540hypothetical protein SORBIDRAFT_04g036200 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3vo0_A0.0000016142836395X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3vnz_A0.0000016142836395X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB3vny_A0.0000016142836395A Chain A, Crystal Structure Of Beta-Glucuronidase From Acidobacterium Capsulatum
Signal Peptide
Cleavage Site
25
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8731563261945160
JG9501182922125030
CD437707284693510
DV483113259913490
GO873156365045390.0000005
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00009.1Aquca_002_00770.2Aquca_002_00771.1Aquca_002_00770.1Aquca_002_00770.3
Aquca_002_00771.4Aquca_002_00771.3Aquca_002_00770.4Aquca_002_00771.2.202.436Aquca_002_00771.2.202.436
Aquca_002_00771.2.40.206Aquca_002_00771.2.40.206
Arabidopsis lyrata493582496280350042497509
Arabidopsis thalianaAT5G34940.2AT5G07830.1AT5G61250.2AT5G61250.1AT5G34940.3
AT5G34940.1
Brachypodium distachyonBradi1g47760.1Bradi3g54370.1Bradi1g70300.1Bradi4g03680.1Bradi4g03680.2
Bradi1g70300.3
Brassica rapaBra038945Bra012974Bra009310
Carica papayaevm.model.supercontig_277.3evm.model.supercontig_187.5evm.model.supercontig_51.106evm.model.supercontig_51.104evm.model.supercontig_51.103
Capsella rubellaCarubv10004531mCarubv10028123mCarubv10002679m
Citrus clementinaCiclev10007919mCiclev10010401mCiclev10019606mCiclev10019304mCiclev10033641m
Citrus sinensisorange1.1g008951morange1.1g037212morange1.1g008762morange1.1g009131morange1.1g009122m
orange1.1g009113morange1.1g009102morange1.1g008834morange1.1g041499morange1.1g013838m
orange1.1g014399morange1.1g019695m
Cucumis sativusCucsa.113020.5Cucsa.113020.2Cucsa.113020.1Cucsa.132500.1Cucsa.198040.1
Cucsa.284640.1Cucsa.201230.1Cucsa.034470.1Cucsa.252720.2Cucsa.252720.1
Eucalyptus grandisEucgr.C02742.1Eucgr.K02497.1Eucgr.B00567.2Eucgr.B00567.1Eucgr.G02460.1
Eucgr.C04395.1Eucgr.B03174.1Eucgr.C02742.2Eucgr.C04395.2Eucgr.C02741.1
Eucgr.C02740.1
Fragaria vescamrna30784.1-v1.0-hybridmrna26075.1-v1.0-hybridmrna11598.1-v1.0-hybridmrna11600.1-v1.0-hybrid
Glycine maxGlyma09g11990.2Glyma09g11990.1Glyma15g23550.1Glyma13g23190.1Glyma17g11670.1
Glyma04g32745.2Glyma04g32745.1Glyma05g00663.1Glyma17g08444.1Glyma06g21551.2
Glyma06g21551.1Glyma02g12760.1Glyma02g12740.1Glyma09g11990.3Glyma05g00663.2
Glyma02g12740.2Glyma06g40075.1Glyma10g27494.1
Gossypium raimondiiGorai.004G108900.2Gorai.004G108900.1Gorai.008G196400.1Gorai.010G059600.1Gorai.006G267500.2
Gorai.006G267500.1Gorai.004G293000.2Gorai.011G285000.1Gorai.011G271100.1Gorai.004G293000.1
Gorai.N016700.1Gorai.011G285200.1Gorai.N009300.1Gorai.010G059600.2Gorai.006G004300.1
Gorai.009G305800.1Gorai.008G196400.2Gorai.006G004400.1Gorai.N021000.1Gorai.006G004500.1
Gorai.010G059600.3Gorai.N009100.1Gorai.006G004200.1Gorai.N009200.1.197.494Gorai.N009200.1.197.494
Gorai.011G284500.1.38.235Gorai.011G284500.1.38.235Gorai.006G021700.1.57.271Gorai.006G021700.1.57.271Gorai.011G284500.1.237.471
Gorai.011G284500.1.237.471Gorai.N009200.1.41.200Gorai.N009200.1.41.200Gorai.011G271700.1Gorai.006G021700.1.269.391
Gorai.006G021700.1.269.391
Linum usitatissimumLus10008823Lus10038109Lus10008038Lus10003468Lus10015737
Lus10021652Lus10034707Lus10001923Lus10004664Lus10036963
Lus10037110Lus10037109Lus10036962Lus10001952
Malus domesticaMDP0000088659MDP0000189628MDP0000242071MDP0000199066MDP0000252327
MDP0000248683
Manihot esculentacassava4.1_032464mcassava4.1_005011mcassava4.1_031502mcassava4.1_005078mcassava4.1_005072m
cassava4.1_004963mcassava4.1_021602mcassava4.1_008768m
Medicago truncatulaMedtr4g116070.1Medtr5g043710.1Medtr4g116040.1Medtr8g091920.1
Mimulus guttatusmgv1a026019mmgv1a004063mmgv1a026758mmgv1a004017mmgv1a004194m
mgv1a008019mmgv1a008017mmgv1a025097mmgv1a011158m
Oryza sativaLOC_Os06g08090.2LOC_Os06g08090.1LOC_Os02g55870.1LOC_Os12g38920.2LOC_Os12g38920.1
LOC_Os03g11320.2LOC_Os03g11320.1LOC_Os07g40740.1
Panicum virgatumPavirv00018673mPavirv00048771mPavirv00008589mPavirv00009033mPavirv00009032m
Pavirv00012019mPavirv00030038mPavirv00060468mPavirv00035109mPavirv00018674m
Pavirv00033639m
Physcomitrella patensPp1s118_67V6.1Pp1s90_137V6.1Pp1s121_77V6.1Pp1s181_80V6.1
Phaseolus vulgarisPhvul.009G212400.1Phvul.003G186600.2Phvul.003G186600.1Phvul.003G171800.1Phvul.002G081000.1
Phvul.003G171800.2Phvul.002G087100.3Phvul.002G087100.2Phvul.002G087100.1
Picea abiesMA_77698g0010MA_10433885g0020MA_93036g0020MA_854085g0010MA_71853g0010
MA_93036g0010.60.248MA_93036g0010.60.248MA_343625g0010MA_269826g0010MA_10433885g0010
MA_93036g0010.317.479MA_93036g0010.317.479
Populus trichocarpaPotri.018G121500.1Potri.018G024200.1Potri.006G062200.2Potri.006G062200.1Potri.010G160800.2
Potri.010G160800.1Potri.010G160800.3Potri.015G049100.4Potri.015G049100.3Potri.015G049100.2
Potri.015G049100.1Potri.018G121500.3Potri.018G121500.2Potri.015G049100.5Potri.010G160800.4
Potri.015G049100.6
Prunus persicappa003883mppa019445mppa003804mppa003813mppa025624m
Ricinus communis29848.m00459029720.m00013730138.m00401530174.m00914230174.m009143
Setaria italicaSi006147mSi035072mSi035071mSi021698m
Selaginella moellendorffii10593113310032458
Sorghum bicolorSb04g036200.1Sb10g005260.1Sb01g043180.1Sb08g019250.1
Thellungiella halophilaThhalv10013186mThhalv10003960mThhalv10003449m
Vitis viniferaGSVIVT01012851001GSVIVT01007918001GSVIVT01012184001GSVIVT01035950001.36.452GSVIVT01035950001.36.452
GSVIVT01035950001.521.878GSVIVT01035950001.521.878
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)