y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi026013m
FamilyGH116
Protein PropertiesLength: 758 Molecular Weight: 84970.7 Isoelectric Point: 6.1458
ChromosomeChromosome/Scaffold: 8 Start: 8954255 End: 8962495
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1165267480
  GQFLYLEGIEYYMWNTYDVHFYASFSLVMLFPKLQISVQRDFAAAVMMHDPEKLRILHDGKWAARKVLGAVPHDLGLYDPWFKVNAYTLYNTDRWKDLNP
  KFVLQVYRDVVATGDKSFARAVWPSVYMAMAYMEQFDKDKDGMIENENFPDQTYDVWSMAGISAYCGGLWVAALQAASALAREVGDEASEKLFWDKYEKA
  KSVYSKLWNGSYFNYDDGDNKVR
Full Sequence
Protein Sequence     Length: 758     Download
MVENGTDEQP KGVSRNCPPA HMNGDEEKVY PGQLPVLTWE HKLTHVRHDL PSFRLTWRET    60
RQLAGIGLRL GRHILEETSK GRVSVIDPMK KRIAKSGQGV PLGGSIGRSY TGDFQRWQLF    120
PGTCEDKPVL ANQFSAFISH QDGRKYSTVL HPGKPDLPKG SEISGIGSWD WNMSGQHSTY    180
HALYPRAWTV YDGEPDPELN IVCRQISPII PHNYQQSSYP AAVFTFTVTN SGHTAADVTL    240
LFTWANSVGG KSELTGYHSN SSMIEKDGVH GILLHHRTAD GQPPVTFAIA AQEKEDIHIS    300
ECPCFLISGN SDGFTAKDMW NSVKEHGSFD HLDPIKTSMC SKPGSSIGAA IAASLKIAPK    360
ATQDVSFSLA WACPEVKFSS GKTYHRRYTK FYGTDVDAAA SLAHDAILEH TTWERQIEDW    420
QDPILQDERF PAWYPVTLFN ELYYLNAGGT IWTDGLPPIQ SLTAIGGKKF SLDMLNDDDV    480
NEMIQQNNTA SDILHRMASI LERMHASIAS NSAIGTTLLH GEENIGQFLY LEGIEYYMWN    540
TYDVHFYASF SLVMLFPKLQ ISVQRDFAAA VMMHDPEKLR ILHDGKWAAR KVLGAVPHDL    600
GLYDPWFKVN AYTLYNTDRW KDLNPKFVLQ VYRDVVATGD KSFARAVWPS VYMAMAYMEQ    660
FDKDKDGMIE NENFPDQTYD VWSMAGISAY CGGLWVAALQ AASALAREVG DEASEKLFWD    720
KYEKAKSVYS KLWNGSYFNY DDGDNKVRQS VWSLPNC*                            780
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43549.0e-2899454372+
COG4354COG43546.0e-45525747239+
pfam12215GBA2_N8.0e-5799420334+
pfam04685DUF6086.0e-92526753232+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAX95400.108275126736At5g49900 [Oryza sativa Japonica Group]
GenBankEEC67936.1017511755hypothetical protein OsI_35656 [Oryza sativa Indica Group]
RefSeqNP_001067588.1017511755Os11g0242100 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002450573.1017511755hypothetical protein SORBIDRAFT_05g007160 [Sorghum bicolor]
RefSeqXP_002528846.102775123754conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR3355472684316960
CB6227322674176810
FF3541752824687460
FL8077602331043360
GD015461242813180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299mcassava4.1_005809m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)