y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi026077m
FamilyGH51
Protein PropertiesLength: 670 Molecular Weight: 74251.9 Isoelectric Point: 6.0403
ChromosomeChromosome/Scaffold: 8 Start: 8889583 End: 8898571
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH511785310
  NLASINLKVAGTSNWTKLEQKLVAKGTNRTSRLQITTHNKGVIWFDQVSLMPADTYKGHGFRSDLISMLLDLKPRFFRFPGGCFVEGEWLRNAFRWRESI
  GPWEERPGHFGDVWHYWTDDGLGYYEYLQLSEDLGAAPIWVFNNGISHHDEVDTAIIAPFVKDVLDGLEFAKGSANSTWGSVRAAMGHPEPFPLKYVAIG
  NEDCGKKHYRGNYLKFYNAIRDAYPDIQMISNCDGSSRRLDHPADLFDFHVYTDSKTLFSMMNEFDSTSRDGPKAFVSEYAVWKRDAGKGSLLASLAEAA
  FLTGLERNSDIVQMASYAPLFVNTNDRRWNPDAIVFNTWQHYGTPSYWMQTLFR
Full Sequence
Protein Sequence     Length: 670     Download
MGSMEGFSPT TIPCLLLLFC LGCKCLASEF ELTQTATVKV DATPELARKI PDTLFGVFFE    60
EINHAGAGGI WAELVSNRGF EAGGPHTPSN IHPWSIVGDD SSIFVATDRS SCFSRNIVAL    120
RMEVLCNDCP AGGVGIYNPG FWGMNIEDGK TYNLVMYVKS PETADLTVSL TSPDGLQNLA    180
SINLKVAGTS NWTKLEQKLV AKGTNRTSRL QITTHNKGVI WFDQVSLMPA DTYKGHGFRS    240
DLISMLLDLK PRFFRFPGGC FVEGEWLRNA FRWRESIGPW EERPGHFGDV WHYWTDDGLG    300
YYEYLQLSED LGAAPIWVFN NGISHHDEVD TAIIAPFVKD VLDGLEFAKG SANSTWGSVR    360
AAMGHPEPFP LKYVAIGNED CGKKHYRGNY LKFYNAIRDA YPDIQMISNC DGSSRRLDHP    420
ADLFDFHVYT DSKTLFSMMN EFDSTSRDGP KAFVSEYAVW KRDAGKGSLL ASLAEAAFLT    480
GLERNSDIVQ MASYAPLFVN TNDRRWNPDA IVFNTWQHYG TPSYWMQTLF RESSGAMVHP    540
ITINSRYSNS LAASAITWQD LGNSFLRVKI VNFGWHAVIV RIATTGLEAS VNAVGSAVTV    600
LTSDNVMDEN SFSHPEKVVP VKRQLRNAAE YMRVRLAPHS LTSFDLALSQ SKLISNVAEK    660
GDESLRSGL*                                                           720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA3.0e-31237640483+
pfam06964Alpha-L-AF_C5.0e-33455640203+
smart00813Alpha-L-AF_C7.0e-44455640198+
Gene Ontology
GO TermDescription
GO:0016798hydrolase activity, acting on glycosyl bonds
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK21880.1016571656AF320325_1 arabinoxylan arabinofuranohydrolase isoenzyme AXAH-II [Hordeum vulgare]
GenBankACN27961.101165710656unknown [Zea mays]
GenBankEEC67598.1016571658hypothetical protein OsI_34967 [Oryza sativa Indica Group]
RefSeqNP_001065660.1016571658Os11g0131900 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_002442705.1016571656hypothetical protein SORBIDRAFT_08g001540 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3s2c_L2e-1923749748327A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_K2e-1923749748327A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_J2e-1923749748327A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_I2e-1923749748327A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
PDB3s2c_H2e-1923749748327A Chain A, Structure Of The Thermostable Gh51 Alpha-L-Arabinofuranosidase From Thermotoga Petrophila Rku-1
Signal Peptide
Cleavage Site
27
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO801860329904180
GT0462043482225690
HO8526834252376570
GT0486153482826280
GT036166331273570
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026076mSi026219mSi009562m
Si026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10020209mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)