y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi029094m
FamilyGH33
Protein PropertiesLength: 700 Molecular Weight: 76853.2 Isoelectric Point: 5.5296
ChromosomeChromosome/Scaffold: 2 Start: 41756318 End: 41760521
DescriptionBNR/Asp-box repeat family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH331134041.1e-26
  AGRSFNNCHASTIVEIEKDNFLVSYFGGSIEGAPDVKIWTQRYSDGYWHPPVVADEENATAMWNPVLFQLPSRELLLFYKIGEHPQNWSGAMKRSLNGGM
  SWSEREQLPPGILGPIKNKPFLLDDGRLLCGSSVESWNSWGAWLEVTDDAGWTWRKYGPIFVESEKLGVIQPVPYQTTNGTIRMLLRSYQTIGRVCIADS
  SDGGLTWGYARKTELPNPNSGIDGIKMKDGRVALAYNTESRGILKVAVSLDDGISWGEVLTLENTEGVEFSYPAVIQTMDELVHVTYTYNRT
Full Sequence
Protein Sequence     Length: 700     Download
MAMPNICCSL SKQHKWKIAA CVMMFSVLLV AFDSPFRTLI SKYLSSIVPS SGSSHDTTLT    60
QENRNLSSER ATNLSNSKPG QQIEHGTHNM NTSSTNATSS WSIVKEEFTF PAAGRSFNNC    120
HASTIVEIEK DNFLVSYFGG SIEGAPDVKI WTQRYSDGYW HPPVVADEEN ATAMWNPVLF    180
QLPSRELLLF YKIGEHPQNW SGAMKRSLNG GMSWSEREQL PPGILGPIKN KPFLLDDGRL    240
LCGSSVESWN SWGAWLEVTD DAGWTWRKYG PIFVESEKLG VIQPVPYQTT NGTIRMLLRS    300
YQTIGRVCIA DSSDGGLTWG YARKTELPNP NSGIDGIKMK DGRVALAYNT ESRGILKVAV    360
SLDDGISWGE VLTLENTEGV EFSYPAVIQT MDELVHVTYT YNRTQIKAAQ AQAVRETGRG    420
KSRASSGSRK VTYGFHLVEG RMPHGMEDRH VAEFRQLDDG NEVGLFAVFD GHSGADVATY    480
LSEHLFDNIL NEPDLDFWTD PMESIRRAYH RTDQKVLKMK KSDDDGGGGE GRKGRRQRGG    540
STAVTVILIN GETLVVANVG DSRAVLRDAA GAARQLSVDH EPLRERSAVE SRGGFVTEIH    600
GDVPRVDAQL AMSRAFGDGA IKEHISSDPD VCIEDVGEGA ELVVLASDGL WKVMSNQEAV    660
DEAGREAAGD ARDAAVRLVD EAVRRGSKDD ISCIVVRLH*                          720
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0631PTC12.0e-26440698268+
pfam00481PP2C9.0e-42444657222+
smart00332PP2Cc2.0e-51433696269+
cd00143PP2Cc4.0e-55446698260+
pfam13088BNR_23.0e-86131397282+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG41080.10903901301hypothetical protein [Zea mays]
GenBankEEC82140.1084077412hypothetical protein OsI_26191 [Oryza sativa Indica Group]
GenBankEEC82140.10107412386680hypothetical protein OsI_26191 [Oryza sativa Indica Group]
RefSeqNP_001059779.1084127417Os07g0516000 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001131252.10883902304hypothetical protein LOC100192565 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3nmn_D3e-2343369814307B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl1 In Complex With Type 2c Protein Phosphatase Abi1
PDB3nmn_B3e-2343369814307B Chain B, Crystal Structure Of Pyrabactin-Bound Abscisic Acid Receptor Pyl1 In Complex With Type 2c Protein Phosphatase Abi1
PDB2p8e_B3e-2344269648295A Chain A, Crystal Structure Of The SerineTHREONINE PHOSPHATASE Domain Of Human Ppm1b
PDB2p8e_A3e-2344269648295A Chain A, Crystal Structure Of The SerineTHREONINE PHOSPHATASE Domain Of Human Ppm1b
PDB3jrq_A5e-2343369826319B Chain B, Crystal Structure Of (+)-aba-bound Pyl1 In Complex With A
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG8133832521133640
FF3443862621434040
EL6890162871123980
JG8628172181033200
FL7356712111683780
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_027_00263.5Aquca_027_00263.1Aquca_027_00263.2Aquca_027_00263.3Aquca_027_00263.4
Arabidopsis lyrata495867
Arabidopsis thalianaAT5G57700.1AT5G57700.2AT5G57700.3AT5G57700.4
Brachypodium distachyonBradi1g26287.2Bradi1g26287.4Bradi1g26287.1Bradi1g26287.3
Brassica rapaBra006806
Capsella rubellaCarubv10028058m
Citrus clementinaCiclev10008429m
Citrus sinensisorange1.1g020796m
Cucumis sativusCucsa.063760.7Cucsa.063760.5Cucsa.063760.1
Eucalyptus grandisEucgr.C02440.3Eucgr.C02440.2Eucgr.C02440.1
Fragaria vescamrna29636.1-v1.0-hybrid
Glycine maxGlyma13g01390.2Glyma13g01380.1Glyma17g07500.2Glyma17g07500.3Glyma17g07500.1
Gossypium raimondiiGorai.010G053100.8Gorai.010G053100.9Gorai.010G053100.6Gorai.012G095700.1Gorai.010G053100.5
Gorai.010G053100.4Gorai.010G053100.3Gorai.010G053100.2Gorai.010G053100.10Gorai.010G053100.1
Linum usitatissimumLus10008903
Malus domesticaMDP0000155009
Manihot esculentacassava4.1_011952m
Medicago truncatulaMedtr4g129200.1Medtr4g129180.1
Mimulus guttatusmgv1a018339m
Oryza sativaLOC_Os07g33220.1LOC_Os07g33224.1
Panicum virgatumPavirv00000088mPavirv00019697mPavirv00063023mPavirv00001202mPavirv00001203m
Pavirv00068158mPavirv00059537m
Physcomitrella patensPp1s96_140V6.2
Phaseolus vulgarisPhvul.003G150200.1Phvul.003G150000.2Phvul.003G150000.1Phvul.003G150000.4Phvul.003G150000.5
Phvul.003G150000.3Phvul.003G150000.6
Picea abiesMA_10435121g0010
Populus trichocarpaPotri.018G097100.1
Prunus persicappa020159m
Ricinus communis29749.m000140
Setaria italicaSi030500mSi030939mSi030026m
Selaginella moellendorffii84263
Sorghum bicolorSb02g034675.1Sb02g034680.1
Thellungiella halophilaThhalv10013983m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny