CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi029845m
FamilyGT50
Protein PropertiesLength: 445 Molecular Weight: 50850.4 Isoelectric Point: 10.0224
ChromosomeChromosome/Scaffold: 2 Start: 15058132 End: 15060878
Descriptionmannosyltransferase family protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT501324200
  IGTRGNCEPIVCAAILWILICLMKGRVFQAAFWYGLIVHFRIYPIIYAIPFVIVLGKSYAGSSGRPTLTLWRSEQHLQNDKSSQREGPTSFLATLWDFLS
  NFITRNAILFGLLSGSMFFVWTGVFFYLYGWEFLNEALLYHLTRTDPRHNFSIYFYHIYLHHQQGFSSIQRLASFLPQLIVQLALILRFCRDLPFCMFLQ
  TVAFVAFNKVMTAQYFVWFFCLLPLILPWSSMKLKWKGLACMLVWMGSQLHWLMWAYLLEFKGRNVFVQLWLAGLVFLAANTFVMLMVI
Full Sequence
Protein Sequence     Length: 445     Download
MAPAAAAVTL RRVLLASAAL RLALVVFGEW QDAHLEVRYT DVDYLVFSDA AASVAAGGSP    60
FARATYRYSP LLAFLLLPNS LLHAAWGKLL FSAADLLVGL FIDTILKLRG IPEKMRMWSV    120
IAWLFNPFTF TIGTRGNCEP IVCAAILWIL ICLMKGRVFQ AAFWYGLIVH FRIYPIIYAI    180
PFVIVLGKSY AGSSGRPTLT LWRSEQHLQN DKSSQREGPT SFLATLWDFL SNFITRNAIL    240
FGLLSGSMFF VWTGVFFYLY GWEFLNEALL YHLTRTDPRH NFSIYFYHIY LHHQQGFSSI    300
QRLASFLPQL IVQLALILRF CRDLPFCMFL QTVAFVAFNK VMTAQYFVWF FCLLPLILPW    360
SSMKLKWKGL ACMLVWMGSQ LHWLMWAYLL EFKGRNVFVQ LWLAGLVFLA ANTFVMLMVI    420
KHHKYTPLFS TPVKPGSKVA TKKE* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam06728PIG-U4.0e-589201124+
pfam05007Mannosyl_trans4.0e-71132420291+
PLN02841PLN02841027444418+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0006506GPI anchor biosynthetic process
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACG32572.1054444443PNT1 [Zea mays]
GenBankEEC75897.1044442444hypothetical protein OsI_12951 [Oryza sativa Indica Group]
RefSeqNP_001050869.1044442444Os03g0670200 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001132411.1054444443hypothetical protein LOC100193858 [Zea mays]
RefSeqXP_002461964.1044443443hypothetical protein SORBIDRAFT_02g011300 [Sorghum bicolor]
Transmembrane Domains
StartEnd
1330
84106
163185
238260
336358
373390
397419
Signal Peptide
Cleavage Site
28
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG9444102661804450
GT0343612931574450
JG8826892681784450
FL9564412591784360
JG9485652182284450
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_040_00057.1Aquca_027_00011.1Aquca_035_00139.1Aquca_027_00005.1Aquca_083_00090.1
Aquca_027_00008.1Aquca_083_00081.1Aquca_008_00278.1
Arabidopsis lyrata910198
Arabidopsis thalianaAT5G22130.2AT5G22130.1
Brachypodium distachyonBradi4g38200.1
Brassica rapaBra020174
Carica papayaevm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.128.333evm.model.supercontig_9.382.364.444evm.model.supercontig_9.382.364.444
Capsella rubellaCarubv10000947m
Chlamydomonas reinhardtiiCre14.g616200.t1.2.125.281Cre14.g616200.t1.2.125.281Cre14.g616200.t1.2.354.469Cre14.g616200.t1.2.354.469
Citrus clementinaCiclev10001079m
Citrus sinensisorange1.1g012470morange1.1g020664morange1.1g014361m.155.293orange1.1g014361m.292.401orange1.1g014361m.292.401
orange1.1g014361m.155.293orange1.1g020629m
Cucumis sativusCucsa.099160.1
Eucalyptus grandisEucgr.H00040.1
Fragaria vescamrna23760.1-v1.0-hybrid
Glycine maxGlyma08g16980.1
Gossypium raimondiiGorai.001G088100.1
Linum usitatissimumLus10000321Lus10013349
Malus domesticaMDP0000259191MDP0000246795MDP0000134018
Manihot esculentacassava4.1_033019m
Medicago truncatulaMedtr8g040610.1
Mimulus guttatusmgv1a006636mmgv1a019000mmgv1a018848m
Oryza sativaLOC_Os03g46750.1
Panicum virgatumPavirv00041326mPavirv00060844m
Physcomitrella patensPp1s171_137V6.1
Phaseolus vulgarisPhvul.005G043300.1
Picea abiesMA_10434160g0010
Populus trichocarpaPotri.001G031500.1Potri.001G031500.2
Prunus persicappa005934m
Ricinus communis30040.m000266
Selaginella moellendorffii90874
Sorghum bicolorSb02g011300.1
Thellungiella halophilaThhalv10015361mThhalv10013575m
Vitis viniferaGSVIVT01017167001
Volvox carteriVocar20014433m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny