CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi034264m
FamilyCE10
Protein PropertiesLength: 832 Molecular Weight: 91289 Isoelectric Point: 6.9614
ChromosomeChromosome/Scaffold: 9 Start: 21730170 End: 21737382
Descriptionacylaminoacyl-peptidase-related
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE105938143.6e-32
  SASNPTIVVLHGGPHSVYPSSYSKSLAFLFSQGYNLLVVNYRGSLGFGEEALQSLPGNIGSQDVNDVLTALDLVIRRGLIDPSKVAVVGGSHGGFLTTHL
  IGQAPDTFVAAAARNPVCNLQLMVGTTDIPDWCFVEIYGKEGKKYFSESPSVDDLCQFHQKSPISHISKVKTPTLFLLGAQDLRVPVSNGLQYARALKER
  GIESKTIVFPEDIHGIDKPQSD
Full Sequence
Protein Sequence     Length: 832     Download
MVVLTTAFIT CAKFHCRSSI AAANLLLVSA SHSRACAPPR GPLLRRRIDK VSLRSIAMAT    60
TQASEAEADK GLPLGMDATM VDEYASQSKL LQEFVKIPSC GKAWIFNSKD ENTSRAVVSI    120
GQSDLLGNKR RKFLLNSHIS KSASKSVDFH WSPFPTEISG VSAVIPSPSG EKLLLVRNSE    180
DDSPTKLEIW GSCQLKNEIH IAKSVHGSLY TDEWFEGISW NQEETFVAYV AEEPPQPKPV    240
FNDYGFKKEG SSEKDCKSWK GQGDWEETWG ETYSKKRIPA LFVVNISSGE VRPVKGIPRS    300
LSVGQVIWAP SPSYGLVFVA WSSDNGFQHT PRKLGIKYCY NRPCALYAAP HPFREEAEKP    360
STEGDKGETT TMIKLTADLN SAFFPRFSPD GKYLVFISAK SAVDSGAHNA TNSMHRIEWP    420
TDGKLDGSLG VADVVPIVMC PKENCFPGLY CFGLLRDPWL TDGRTMILSS VWGSKEVVLS    480
INVVSCEVLR VSPQDSDCSW NVLALDKNDI LAVSSSLITL PQIYYGIKVS QIESHWEWQE    540
VSTPLPKLSD EISSILSEHK FSILKVPISN LSDKLADGAK LPFEAIFVSH KDSASNPTIV    600
VLHGGPHSVY PSSYSKSLAF LFSQGYNLLV VNYRGSLGFG EEALQSLPGN IGSQDVNDVL    660
TALDLVIRRG LIDPSKVAVV GGSHGGFLTT HLIGQAPDTF VAAAARNPVC NLQLMVGTTD    720
IPDWCFVEIY GKEGKKYFSE SPSVDDLCQF HQKSPISHIS KVKTPTLFLL GAQDLRVPVS    780
NGLQYARALK ERGIESKTIV FPEDIHGIDK PQSDFESFLN IGVWFKKHLS K*            840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0657Aes2.0e-10577830275+
pfam12697Abhydrolase_64.0e-11599802204+
COG1505COG15054.0e-13576830268+
pfam00326Peptidase_S91.0e-36613831221+
COG1506DAP29.0e-51373831462+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB47613.1018311839prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABB47614.10768301764prolyl oligopeptidase family protein, expressed [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064602.10588311775Os10g0415600 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001064603.10698304774Os10g0415800 [Oryza sativa (japonica cultivar-group)]
RefSeqNP_001151758.10588311774LOC100285393 [Zea mays]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4hxf_B6e-20591807373579A Chain A, E292q Mutant Of Exo-B-(1,3)-Glucanase From Candida Albicans In Complex With Two Separately Bound Glucopyranoside Units At 1.8 A
PDB4hxe_B6e-20591807373579B Chain B, Pyrococcus Horikoshii Acylaminoacyl Peptidase (uncomplexed)
PDB4hxg_L1e-19591807373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_K1e-19591807373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
PDB4hxg_J1e-19591807373579A Chain A, Pyrococcus Horikoshii Acylaminoacyl Peptidase (orthorhombic Crystal Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO8504863414898270
GO8504843364898220
GO8725903231724940
EB6693982652084720
JG8943692834417230
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105mcassava4.1_005468m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)