y PlantCAZyme

CAZyme Information

Basic Information
SpeciesSetaria italica
Cazyme IDSi040167m
FamilyGH95
Protein PropertiesLength: 345 Molecular Weight: 38854.4 Isoelectric Point: 6.2661
ChromosomeChromosome/Scaffold: 9 Start: 24688061 End: 24690518
Description1,2-alpha-L-fucosidases
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH9523380
  NYQTSGWVIHHKSDIWAKSSASNGDPQYAVWPMGGAWLCTHIWEHYQYSLDKVFLENAYPLLEGCALFLVDWLIEGPQGYLETNPSTSPEHSFIAPATGG
  HNASVSYSTTMDISIIREIFLAVIASAEVLGKYDTTLVQRINQALPRLPPIMIAKDCTIMEWALDFEDPDVHHRHQSHLFGLYPGHTITMERNPDICQAA
  ANSLHKRGEDGPGWSLTWKMALWARLMDSKNAYRMILKLINLVPPTEKFGLNGGLYTNLWTAHPPFQIDANFGFTAALAEMLLQSTLTDLYLLPALPRNK
  WPRGCVKGLKARRDVIVSICWEEGELQEALLYSGRGD
Full Sequence
Protein Sequence     Length: 345     Download
TNYQTSGWVI HHKSDIWAKS SASNGDPQYA VWPMGGAWLC THIWEHYQYS LDKVFLENAY    60
PLLEGCALFL VDWLIEGPQG YLETNPSTSP EHSFIAPATG GHNASVSYST TMDISIIREI    120
FLAVIASAEV LGKYDTTLVQ RINQALPRLP PIMIAKDCTI MEWALDFEDP DVHHRHQSHL    180
FGLYPGHTIT MERNPDICQA AANSLHKRGE DGPGWSLTWK MALWARLMDS KNAYRMILKL    240
INLVPPTEKF GLNGGLYTNL WTAHPPFQID ANFGFTAALA EMLLQSTLTD LYLLPALPRN    300
KWPRGCVKGL KARRDVIVSI CWEEGELQEA LLYSGRGDSD LKLHY                    360
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABG66022.101345438785large secreted protein, putative, expressed [Oryza sativa (japonica cultivar-group)]
GenBankABG66023.101345331678large secreted protein, putative, expressed [Oryza sativa (japonica cultivar-group)]
DDBJBAF85832.101345482825alpha-1,2-fucosidase [Lilium longiflorum]
GenBankEEC79728.101345438785hypothetical protein OsI_21058 [Oryza sativa Indica Group]
RefSeqXP_002461732.102335503835hypothetical protein SORBIDRAFT_02g007180 [Sorghum bicolor]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2rdy_B02336412746A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2rdy_A02336412746A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_B1e-3038337510844A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eac_A1e-3038337510844A Chain A, Crystal Structure Of A Putative Glycoside Hydrolase Family Protein From Bacillus Halodurans
PDB2eab_B1e-3038337510844A Chain A, Crystal Structure Of 1,2-A-L-Fucosidase From Bifidobacterium Bifidum (Apo Form)
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GO876621315333450
CN010952245242670
ES811142296353290
JG890568265503130
CO48170930293090
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_083_00007.1Aquca_083_00007.2Aquca_083_00007.3Aquca_083_00007.4Aquca_083_00007.5
Aquca_083_00007.6
Arabidopsis lyrata912968
Arabidopsis thalianaAT4G34260.1
Brachypodium distachyonBradi1g28366.1Bradi3g25226.2Bradi3g25226.1
Brassica rapaBra011514
Carica papayaevm.model.supercontig_106.113
Capsella rubellaCarubv10004274m
Citrus clementinaCiclev10027816mCiclev10027838mCiclev10027896mCiclev10027914m
Citrus sinensisorange1.1g003571morange1.1g003209morange1.1g004833morange1.1g004823morange1.1g007147m
orange1.1g007141morange1.1g007204morange1.1g010926morange1.1g012384m
Cucumis sativusCucsa.108860.1
Eucalyptus grandisEucgr.I01092.1Eucgr.I01093.1Eucgr.I01092.2Eucgr.I01091.1Eucgr.I01092.3
Fragaria vescamrna22851.1-v1.0-hybrid.28.414mrna22851.1-v1.0-hybrid.28.414mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.28.420mrna22843.1-v1.0-hybrid.490.804
mrna22843.1-v1.0-hybrid.490.804mrna22851.1-v1.0-hybrid.412.731mrna22851.1-v1.0-hybrid.412.731
Glycine maxGlyma20g26646.1Glyma10g40690.1Glyma20g26653.1Glyma01g45470.1Glyma10g40690.2
Glyma10g40690.3Glyma10g40690.4Glyma01g45470.2
Gossypium raimondiiGorai.008G022000.1Gorai.008G022200.1Gorai.008G022200.3Gorai.008G022200.2Gorai.008G022000.2
Gorai.008G022000.3
Linum usitatissimumLus10020979Lus10026594Lus10029689Lus10013884Lus10026595.318.693
Lus10026595.318.693Lus10026595.49.314Lus10026595.49.314
Malus domesticaMDP0000212784MDP0000623980MDP0000623979
Manihot esculentacassava4.1_001723mcassava4.1_005093mcassava4.1_008652mcassava4.1_021629m
Medicago truncatulaMedtr4g127370.1
Mimulus guttatusmgv1a001249m
Oryza sativaLOC_Os10g19334.1LOC_Os10g19880.1LOC_Os10g19334.2
Panicum virgatumPavirv00068345mPavirv00058326mPavirv00053527mPavirv00056040mPavirv00052622m
Pavirv00070327mPavirv00065921m
Physcomitrella patensPp1s174_46V6.2.375.814Pp1s174_46V6.2.375.814Pp1s174_46V6.1.375.814Pp1s174_46V6.1.375.814Pp1s11165_1V6.1
Phaseolus vulgarisPhvul.007G041400.1Phvul.002G053000.1
Picea abiesMA_6830674g0010MA_10427365g0010
Populus trichocarpaPotri.009G093900.1Potri.001G299000.6Potri.001G299000.1Potri.009G093500.1Potri.001G298900.1
Potri.001G299000.4Potri.009G093500.3Potri.001G298900.2Potri.001G299000.9Potri.001G299000.7
Potri.009G093500.2Potri.001G299000.5Potri.001G299000.2Potri.001G299000.3Potri.001G299000.11
Potri.009G093500.4Potri.001G299000.10Potri.001G299000.8Potri.001G299000.12
Prunus persicappa001398m
Ricinus communis28152.m00088228152.m000881
Setaria italicaSi040042mSi035391mSi037248mSi037505m
Selaginella moellendorffii171005
Sorghum bicolorSb02g007180.1
Thellungiella halophilaThhalv10024398m
Vitis viniferaGSVIVT01037900001.265.748GSVIVT01037900001.265.748GSVIVT01037900001.32.242GSVIVT01037900001.32.242
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)