CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10000958m
FamilyAA2
Protein PropertiesLength: 331 Molecular Weight: 36707 Isoelectric Point: 7.778
ChromosomeChromosome/Scaffold: 20 Start: 2122996 End: 2124411
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA2433100
  KIVREAVSTKQSQQPTTAAGTLRLFFHDCFLEGCDASVLIATNSFNKAERDDDLNDSLPGDAFDIVTRIKTALELSCPSVVSCADILAQATRDLVTMVGG
  PYFDVKLGRKDGLESKAHKVRGNVPMPNQTVHDIHGMFKKNGFTLREMVALSGAHTIGFSHCKEFSDRLYGPKADPEINPRFATALKDLCKNHTVDDTIA
  AFNDVMTPGKFDNMYFKNLKRGLGLLASDHILFKNNRTRPFVELYASDEKAFFEDFARAMEKLGTVGV
Full Sequence
Protein Sequence     Length: 331     Download
MRLSRGPNPF VLLFVLIVAP AVSADVAILR TDYYQKTCPD FNKIVREAVS TKQSQQPTTA    60
AGTLRLFFHD CFLEGCDASV LIATNSFNKA ERDDDLNDSL PGDAFDIVTR IKTALELSCP    120
SVVSCADILA QATRDLVTMV GGPYFDVKLG RKDGLESKAH KVRGNVPMPN QTVHDIHGMF    180
KKNGFTLREM VALSGAHTIG FSHCKEFSDR LYGPKADPEI NPRFATALKD LCKNHTVDDT    240
IAAFNDVMTP GKFDNMYFKN LKRGLGLLAS DHILFKNNRT RPFVELYASD EKAFFEDFAR    300
AMEKLGTVGV KGDKEGEVRR RCDHFNNLNV * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd00691ascorbate_peroxidase6.0e-27123313202+
cd00314plant_peroxidase_like5.0e-2760306277+
pfam00141peroxidase6.0e-5445199155+
PLN03030PLN030303.0e-6511326326+
cd00693secretory_peroxidase2.0e-14929325301+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAM65654.1013304334peroxidase [Arabidopsis thaliana]
GenBankABD65151.10113309329peroxidase, putative [Brassica oleracea]
GenBankACT35474.1013301330peroxidase 65 [Brassica rapa]
DDBJBAB10239.1013301331peroxidase [Arabidopsis thaliana]
RefSeqNP_568674.1013304334peroxidase, putative [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1bgp_A0293269305A Chain A, Crystal Structure Of Barley Grain Peroxidase 1
PDB3hdl_A0293272304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qo4_A0293263304A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1pa2_A0293263304A Chain A, Arabidopsis Thaliana Peroxidase A2
PDB1sch_B0293262294A Chain A, Peanut Peroxidase
Transmembrane Domains
StartEnd
729
Signal Peptide
Cleavage Site
24
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
GR459999272403110
FY43108727512750
EX08714026612660
GR46260325712570
ES27176025512550
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00027.1Aquca_024_00108.1Aquca_005_00129.1Aquca_002_00311.1Aquca_025_00191.1
Arabidopsis lyrata919965866364490867861804857592
900345494280914938889956916251
484603
Arabidopsis thalianaAT5G67400.1AT4G37530.1AT4G37520.1AT4G37520.2AT3G49960.1
AT5G14130.1AT4G30170.1AT2G18980.1AT5G47000.1AT4G17690.1
AT1G24110.1AT5G40150.1AT2G34060.1AT3G28200.1AT4G37530.2
Brachypodium distachyonBradi1g58997.1Bradi3g41340.1Bradi1g07780.1Bradi2g46050.1Bradi3g59660.1
Bradi5g12710.1Bradi1g07790.1Bradi5g24650.1Bradi1g33740.1Bradi1g33730.1
Bradi3g29500.1
Brassica rapaBra031832Bra037849Bra024102Bra023449Bra011771
Bra011170Bra008775Bra022090Bra024635Bra040175
Bra039059Bra017830Bra033040Bra025604Bra005458
Bra005456Bra024972Bra017514Bra012649
Carica papayaevm.model.supercontig_171.8evm.model.supercontig_95.38evm.model.supercontig_7.30evm.model.supercontig_367.2evm.model.supercontig_6.43
evm.model.supercontig_23.12
Capsella rubellaCarubv10001386mCarubv10027970mCarubv10005222mCarubv10017623mCarubv10005239m
Carubv10016330mCarubv10027696mCarubv10005246mCarubv10007561mCarubv10007381m
Carubv10023544mCarubv10019066mCarubv10007328m
Citrus clementinaCiclev10032081mCiclev10016043mCiclev10026050mCiclev10010461mCiclev10031996m
Ciclev10017786mCiclev10012179mCiclev10020412m
Citrus sinensisorange1.1g039410morange1.1g020449morange1.1g046044morange1.1g036989morange1.1g039451m
orange1.1g039892morange1.1g021112morange1.1g039585m
Cucumis sativusCucsa.087760.1Cucsa.087780.1Cucsa.234060.1Cucsa.103030.1Cucsa.087770.1
Cucsa.127000.1Cucsa.311010.1Cucsa.158870.1Cucsa.339390.1Cucsa.098230.1
Cucsa.197190.1Cucsa.087770.2Cucsa.103030.2
Eucalyptus grandisEucgr.J02352.1Eucgr.I00717.1Eucgr.B03369.1Eucgr.C02389.1Eucgr.C02212.1
Eucgr.I02385.1Eucgr.E02655.1Eucgr.E03164.1Eucgr.J02173.1
Fragaria vescamrna28350.1-v1.0-hybridmrna01331.1-v1.0-hybridmrna17026.1-v1.0-hybridmrna09482.1-v1.0-hybridmrna08703.1-v1.0-hybrid
mrna09483.1-v1.0-hybridmrna01539.1-v1.0-hybridmrna01661.1-v1.0-hybridmrna25852.1-v1.0-hybrid.160.331mrna25852.1-v1.0-hybrid.160.331
Glycine maxGlyma05g22180.1Glyma17g17730.1Glyma16g06030.1Glyma19g25980.1Glyma01g39990.1
Glyma11g05300.1Glyma10g34190.1Glyma17g29320.1Glyma17g06890.1Glyma20g33340.1
Glyma13g00790.1Glyma15g17620.1Glyma09g06350.1Glyma13g24110.1Glyma08g40280.1
Glyma19g01620.1Glyma13g04590.1Glyma18g17410.2Glyma17g17730.3Glyma17g17730.2
Glyma15g21530.2
Gossypium raimondiiGorai.001G271800.1Gorai.012G086300.1Gorai.001G271900.1Gorai.003G029000.1Gorai.008G080800.3
Gorai.008G080800.2Gorai.008G080800.1Gorai.012G086200.1Gorai.009G165100.1Gorai.002G164800.1
Gorai.004G098800.1Gorai.002G165200.1Gorai.011G107800.1Gorai.001G001800.1Gorai.004G098800.2
Gorai.008G298000.1Gorai.001G259400.1Gorai.012G086300.2Gorai.006G187600.1Gorai.012G059300.1
Linum usitatissimumLus10012540Lus10011079Lus10032035Lus10039445Lus10010716
Lus10013955Lus10001442Lus10005278Lus10042144Lus10004234
Lus10029201Lus10001622Lus10035204Lus10014517Lus10032170
Lus10039471
Malus domesticaMDP0000488361MDP0000142485MDP0000501768MDP0000120959MDP0000166657
MDP0000282167MDP0000136398MDP0000172233MDP0000501770
Manihot esculentacassava4.1_022283mcassava4.1_024093mcassava4.1_011662mcassava4.1_031946mcassava4.1_029287m
cassava4.1_021806mcassava4.1_027345mcassava4.1_012020mcassava4.1_032477m
Medicago truncatulaMedtr5g016010.1Medtr2g089750.1Medtr4g095450.1Medtr4g127670.1Medtr8g062780.1
Medtr6g008080.1Medtr4g095450.2Medtr2g089750.2
Mimulus guttatusmgv1a009638mmgv1a026768mmgv1a009228mmgv1a009564mmgv1a009838m
mgv1a018871mmgv1a009833mmgv1a025312mmgv1a014486m
Oryza sativaLOC_Os09g32964.1LOC_Os03g55420.1LOC_Os07g02440.1LOC_Os08g42030.1LOC_Os02g50770.1
LOC_Os04g39100.1LOC_Os06g13050.1LOC_Os03g55410.1LOC_Os06g48030.1LOC_Os04g56180.1
LOC_Os06g48010.1LOC_Os06g48000.1LOC_Os06g48020.1LOC_Os06g48030.3
Panicum virgatumPavirv00053308mPavirv00060390mPavirv00010650mPavirv00037982mPavirv00016094m
Pavirv00017282mPavirv00047135mPavirv00017773mPavirv00048020mPavirv00044128m
Pavirv00040390mPavirv00037974mPavirv00021422mPavirv00031680mPavirv00032399m
Pavirv00031557mPavirv00010961mPavirv00033315mPavirv00003997mPavirv00035038m
Pavirv00051442mPavirv00012594mPavirv00040391mPavirv00013716mPavirv00054728m
Pavirv00039004mPavirv00021264mPavirv00012090m
Phaseolus vulgarisPhvul.003G236500.1Phvul.002G012300.1Phvul.001G092900.1Phvul.001G059100.1Phvul.003G143400.1
Phvul.003G057000.1Phvul.009G238400.1Phvul.007G140900.1Phvul.003G055700.1Phvul.004G020100.1
Picea abiesMA_10g0010MA_10431460g0010MA_119796g0010MA_166386g0010MA_941794g0010
MA_9873048g0010MA_132958g0020MA_10436898g0010MA_54671g0010MA_1038g0010
MA_9110627g0010MA_13722g0010
Populus trichocarpaPotri.007G074700.1Potri.007G053400.1Potri.017G064100.1Potri.018G089900.1Potri.001G329200.1
Potri.004G052100.1Potri.010G036100.1Potri.012G076500.1Potri.011G062300.1Potri.001G351000.1
Prunus persicappa015245mppa008489mppa008577mppa021596mppa008569m
ppa017084mppa021819mppa010109mppa008550m
Ricinus communis30190.m01091629661.m00089930147.m01400529900.m00156628138.m000074
29822.m003401
Setaria italicaSi036628mSi030428mSi030497mSi019549mSi014043m
Si010547mSi001945mSi036611mSi007872mSi006833m
Si022620mSi006924mSi006929mSi008457m
Selaginella moellendorffii10490597331132875403769231472
16427114315526986279034231875
132865122262
Sorghum bicolorSb02g029340.1Sb03g030630.1Sb01g007230.1Sb07g026130.1Sb02g001140.1
Sb04g028340.1Sb01g007240.1Sb10g028500.1Sb06g019280.2Sb06g019280.1
Sb06g031300.1Sb10g028460.1Sb10g028480.1Sb10g028470.1Sb02g001130.1
Thellungiella halophilaThhalv10004576mThhalv10014070mThhalv10010538mThhalv10025695mThhalv10025699m
Thhalv10025717mThhalv10025673mThhalv10004596mThhalv10009658mThhalv10016874m
Vitis viniferaGSVIVT01026134001GSVIVT01021152001GSVIVT01029241001GSVIVT01033081001GSVIVT01000144001
Zea maysAC211164.5_FGT004AC230013.2_FGT002AC210003.2_FGT004
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)