Basic Information | |
---|---|
Species | Thellungiella halophila |
Cazyme ID | Thhalv10002820m |
Family | CBM43 |
Protein Properties | Length: 119 Molecular Weight: 13073.1 Isoelectric Point: 7.8776 |
Chromosome | Chromosome/Scaffold: 4 Start: 3751293 End: 3751725 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 31 | 110 | 3e-30 |
WCVADPQIPEKVLQAALDWACQQGGADCSLIHPSQPCFLPNTVKDHASVVFNSYYQHYKRKGGSCYFHSAALITLTDPSK |
Full Sequence |
---|
Protein Sequence Length: 119 Download |
MMKTFLIKTT ISLFLISVTF PQDSEAATGV WCVADPQIPE KVLQAALDWA CQQGGADCSL 60 IHPSQPCFLP NTVKDHASVV FNSYYQHYKR KGGSCYFHSA ALITLTDPSK QLYLNSKV* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 8.0e-19 | 31 | 101 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 6.0e-33 | 31 | 109 | 79 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | NP_001154494.1 | 1.99993e-41 | 24 | 109 | 8 | 93 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_178568.1 | 0 | 24 | 115 | 8 | 99 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_198423.1 | 4e-39 | 2 | 109 | 1 | 109 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002321180.1 | 3e-36 | 2 | 109 | 1 | 107 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002531703.1 | 8e-38 | 2 | 112 | 1 | 110 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 1e-18 | 21 | 109 | 3 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |