Basic Information | |
---|---|
Species | Thellungiella halophila |
Cazyme ID | Thhalv10011991m |
Family | CBM43 |
Protein Properties | Length: 110 Molecular Weight: 12359.5 Isoelectric Point: 8.8545 |
Chromosome | Chromosome/Scaffold: 7 Start: 7451107 End: 7451808 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 23 | 103 | 2.5e-31 |
WCVAKPATKNKKLLEIIKFACSEVDCKIISKGGPCYSPNDLLNHASVAMNLYYQAQGRHYWNCYFGGSGIIAITDPSSGNC |
Full Sequence |
---|
Protein Sequence Length: 110 Download |
MANAHLCLFF IIFLYLFFGH GYWCVAKPAT KNKKLLEIIK FACSEVDCKI ISKGGPCYSP 60 NDLLNHASVA MNLYYQAQGR HYWNCYFGGS GIIAITDPSS GNCIYKFRR* |
Functional Domains Download unfiltered results here | ||||||
---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description |
pfam07983 | X8 | 9.0e-18 | 23 | 92 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. |
smart00768 | X8 | 2.0e-33 | 23 | 105 | 84 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64039.1 | 2e-39 | 1 | 100 | 1 | 112 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 7.00649e-43 | 4 | 109 | 3 | 120 | At2g43670 [Arabidopsis thaliana] |
RefSeq | NP_177973.4 | 1e-37 | 1 | 106 | 1 | 115 | unknown protein [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 7.00649e-45 | 1 | 109 | 1 | 121 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | XP_002528491.1 | 3e-34 | 1 | 105 | 1 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 5e-20 | 21 | 106 | 11 | 97 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |