y PlantCAZyme

CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10012108m
FamilyGH1
Protein PropertiesLength: 502 Molecular Weight: 56720.3 Isoelectric Point: 7.813
ChromosomeChromosome/Scaffold: 7 Start: 2727668 End: 2730483
Descriptionbeta glucosidase 34
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1475010
  TGFPNNFTFGAATSAYQIEGAARRAFNGWDYYTHRYPERVPDRSTGDLACNSYELYKDDVQLLKKLNVQAYRFSIAWSRVLPKGSLIGGIDENGIKYYNN
  LINELKANGIEPYVTIFHWDVPQTLEDKYEGFLSPLIVEDYKNYAELLFQRFGDRVKFWITFNQPYSFATKGYGDGSYPPGRCTGCEFGGNSGTEPYVVA
  HHQLLAHAKTVSIYREKYQKLQGGKIGTTLIGRWFVPLDKLSIRDNAAAKRAFDFFVGWFLDPLVYGDYPLIMKVLVGERLPRFTLQESEMVRGSLDFLG
  LNYYVSQYATDAPPPLPSQPNVSTDPRVTLSFYRNGIPIGVQAPSFVYYPPGFRNILNYIKEKYKNPLTYITENGVADFGNLTLADALADNGRIQCHCSH
  LSCLKCAIGDGCNVAGYFAWSSMDNYEFGNGFTLRFGMNWVNFTNPVDRRQKDSG
Full Sequence
Protein Sequence     Length: 502     Download
MDIPKAHFSL AILVILFAVS SCQNVCNPAC KAKEPFDCDN PLTFNRTGFP NNFTFGAATS    60
AYQIEGAARR AFNGWDYYTH RYPERVPDRS TGDLACNSYE LYKDDVQLLK KLNVQAYRFS    120
IAWSRVLPKG SLIGGIDENG IKYYNNLINE LKANGIEPYV TIFHWDVPQT LEDKYEGFLS    180
PLIVEDYKNY AELLFQRFGD RVKFWITFNQ PYSFATKGYG DGSYPPGRCT GCEFGGNSGT    240
EPYVVAHHQL LAHAKTVSIY REKYQKLQGG KIGTTLIGRW FVPLDKLSIR DNAAAKRAFD    300
FFVGWFLDPL VYGDYPLIMK VLVGERLPRF TLQESEMVRG SLDFLGLNYY VSQYATDAPP    360
PLPSQPNVST DPRVTLSFYR NGIPIGVQAP SFVYYPPGFR NILNYIKEKY KNPLTYITEN    420
GVADFGNLTL ADALADNGRI QCHCSHLSCL KCAIGDGCNV AGYFAWSSMD NYEFGNGFTL    480
RFGMNWVNFT NPVDRRQKDS GK                                             540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02814PLN028145.0e-11944496466+
COG2723BglB2.0e-12049501468+
PLN02849PLN028492.0e-12344496462+
TIGR03356BGL1.0e-12350502457+
pfam00232Glyco_hydro_11.0e-17249502462+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD46026.1015021488AC007519_11 Similar to gi
GenBankAAG52628.1015021457AC024261_15 myrosinase precursor, putative; 53323-50499 [Arabidopsis thaliana]
GenBankACO95141.1015021504beta-thioglucoside glucohydrolase [Arabidopsis thaliana]
RefSeqNP_175191.2015021503BGLU34 (BETA GLUCOSIDASE 34); hydrolase, hydrolyzing O-glycosyl compounds / thioglucosidase [Arabidopsis thaliana]
RefSeqNP_175558.3015021503BGLU35 (BETA GLUCOSIDASE 35); catalytic/ cation binding / hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ptq_B0185011496B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ptq_A0185011496B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ptm_B0185011496B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ptm_A0185011496B Chain B, The Avrptob-Bak1 Complex Reveals Two Structurally Similar Kinaseinteracting Domains In A Single Type Iii Effector
PDB3ptk_B0185011496A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12
Signal Peptide
Cleavage Site
22
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES900918275323060
ES90779426412640
ES90925225612560
ES90606525912590
EV11754125512550
Orthologous Group
SpeciesID
Arabidopsis lyrata917734489446
Arabidopsis thalianaAT5G25980.1AT5G26000.1AT5G48375.1AT5G25980.2AT1G51490.1
AT5G26000.2AT5G25980.3
Brassica rapaBra016676Bra039823Bra039705Bra039824Bra004012
Bra014287Bra038094Bra023838Bra032343Bra036914
Bra020523.35.161Bra020523.35.161Bra020549
Carica papayaevm.model.supercontig_17.152
Capsella rubellaCarubv10000656mCarubv10007356m.543.827Carubv10007356m.543.827Carubv10006917mCarubv10022237m
Carubv10007356m.45.502Carubv10007356m.45.502
Linum usitatissimumLus10012868
Thellungiella halophilaThhalv10002474mThhalv10004165mThhalv10001184mThhalv10002471mThhalv10002470m
Thhalv10003945mThhalv10003954mThhalv10012086mThhalv10000681mThhalv10011390m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny