Basic Information | |
---|---|
Species | Thellungiella halophila |
Cazyme ID | Thhalv10012146m |
Family | CBM43 |
Protein Properties | Length: 95 Molecular Weight: 10556.3 Isoelectric Point: 6.7272 |
Chromosome | Chromosome/Scaffold: 7 Start: 7590136 End: 7590671 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
External Links |
---|
CAZyDB |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 20 | 95 | 2.5e-28 |
WCVAKPATKNEKLLQIINYACSKVDCKIISEGGACYSPNDLFNLASVAMNLYYQAQGRHFSNCDFEGSGIITITDP |
Full Sequence |
---|
Protein Sequence Length: 95 Download |
MAKAHLCLCF IILLHFFSDW CVAKPATKNE KLLQIINYAC SKVDCKIISE GGACYSPNDL 60 FNLASVAMNL YYQAQGRHFS NCDFEGSGII TITDP |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 2.0e-16 | 20 | 89 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-27 | 20 | 95 | 77 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAB64039.1 | 8.00001e-42 | 1 | 95 | 1 | 110 | putative beta-1,3-glucanase, C terminal fragment [Arabidopsis thaliana] |
GenBank | AAT41831.1 | 5e-39 | 4 | 95 | 3 | 109 | At2g43670 [Arabidopsis thaliana] |
DDBJ | BAB02616.1 | 3e-34 | 3 | 95 | 5 | 111 | beta-1,3-glucanase-like protein [Arabidopsis thaliana] |
RefSeq | NP_181895.2 | 8.00001e-42 | 1 | 95 | 1 | 110 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
RefSeq | NP_189465.1 | 1e-30 | 19 | 95 | 2 | 78 | glycosyl hydrolase family protein 17 [Arabidopsis thaliana] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-19 | 20 | 95 | 13 | 89 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |