CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10020209m
FamilyGH51
Protein PropertiesLength: 678 Molecular Weight: 74691 Isoelectric Point: 5.2093
ChromosomeChromosome/Scaffold: 13 Start: 5985295 End: 5989922
Descriptionalpha-L-arabinofuranosidase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH512276580
  GSIWIDQVSAMPVDTYKGHGFRNDLFQMMVDIKPRFIRFPGGCFVEGEWLSNAFRWKETVGPWEERPGHFGDVWKYWTDDGLGHFEFFQLAEDIGAAPIW
  VFNNGISHNDEVETASVMPFVQEALDGIEFARGDANSTWGSVRAAMGRQEPFELKYVAIGNEDCGKTYYKGNYIVFYNAIKKAYPDIKIISNCDGSSRPL
  DHPADYYDYHIYTSASSLFSMYHQFDRTSRNGPKAFVSEYAVTGKDAGTGSLLAALAEAAFLIGLEKNSDIVEMASYAPLFVNTNDRRWNPDAIVFNSSH
  LYGTPSYWVQRFFAESSGSTLLASTLKGNSSSLVASAITWQNNGKDYIRIKAVNFGASSVNLKVLVTGLDPNVMKVSGSKKTILTSTNVMDENSFTQPEK
  VVPHESLLEMAEEDLTVILPPHSFSSFDLLKE
Full Sequence
Protein Sequence     Length: 678     Download
MDTESWKFLR SVCILSFLLG SCFVYQSLRV VVAQEDTKPS VTLQVDASYG AGRPIPETLF    60
GIFFEEINHA GAGGLWAELV SNRGFEAGGQ NTPSNIWPWS IVGDQSSIYV ATDRSSLFER    120
NKIALRMDVL CDSNGCPSGG VGVYNPGYWG MNIEEGKKYK VAFYVRSTGD IDLSVSLTSS    180
NGSLTLASEN IIASASDVSK WTKKEVLLVA KGTDHGARLQ LTTSKKGSIW IDQVSAMPVD    240
TYKGHGFRND LFQMMVDIKP RFIRFPGGCF VEGEWLSNAF RWKETVGPWE ERPGHFGDVW    300
KYWTDDGLGH FEFFQLAEDI GAAPIWVFNN GISHNDEVET ASVMPFVQEA LDGIEFARGD    360
ANSTWGSVRA AMGRQEPFEL KYVAIGNEDC GKTYYKGNYI VFYNAIKKAY PDIKIISNCD    420
GSSRPLDHPA DYYDYHIYTS ASSLFSMYHQ FDRTSRNGPK AFVSEYAVTG KDAGTGSLLA    480
ALAEAAFLIG LEKNSDIVEM ASYAPLFVNT NDRRWNPDAI VFNSSHLYGT PSYWVQRFFA    540
ESSGSTLLAS TLKGNSSSLV ASAITWQNNG KDYIRIKAVN FGASSVNLKV LVTGLDPNVM    600
KVSGSKKTIL TSTNVMDENS FTQPEKVVPH ESLLEMAEED LTVILPPHSF SSFDLLKESA    660
KIRMPISDSS STSSQKV* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3534AbfA0.001493651177+
COG3534AbfA1.0e-30246391146+
pfam06964Alpha-L-AF_C3.0e-37492649168+
smart00813Alpha-L-AF_C6.0e-45492649166+
Gene Ontology
GO TermDescription
GO:0046373L-arabinose metabolic process
GO:0046556alpha-N-arabinofuranosidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAK50089.1016711671AF372949_1 AT3g10740/T7M13_18 [Arabidopsis thaliana]
GenBankAAO92261.1016711671alpha-L-arabinofuranosidase [Arabidopsis thaliana]
RefSeqNP_187685.1016711671ASD1 (ALPHA-L-ARABINOFURANOSIDASE 1); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds / xylan 1,4-beta-xylosidase [Arabidopsis thaliana]
RefSeqNP_197984.2016741672ASD2 (ALPHA-L-ARABINOFURANOSIDASE 2); alpha-N-arabinofuranosidase/ hydrolase, acting on glycosyl bonds [Arabidopsis thaliana]
RefSeqXP_002523672.103667435677Alpha-N-arabinofuranosidase 1 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ug5_F4e-1724655968393A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3ug5_E4e-1724655968393A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3ug5_D4e-1724655968393A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3ug5_C4e-1724655968393A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
PDB3ug5_B4e-1724655968393A Chain A, Crystal Structure Of The Polygalacturonase From Colletotrichum Lupini And Its Implications For The Interaction With Polygalacturonase- Inhibiting Proteins
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
BX84131133313330
HO8526834142466550
HO7807403942746640
HO8072913181534700
JG5770273331034350
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00046.1Aquca_009_00046.3Aquca_009_00046.2
Arabidopsis lyrata478409489456855811
Arabidopsis thalianaAT3G10740.1AT5G26120.1
Brachypodium distachyonBradi4g43710.1Bradi4g26270.1Bradi4g26270.3Bradi1g57017.1Bradi4g26270.2
Bradi1g17257.1Bradi1g63990.2Bradi1g63990.1
Brassica rapaBra034141Bra002009Bra027763Bra009423Bra009083
Bra001376
Carica papayaevm.model.supercontig_33.202evm.model.supercontig_34.172evm.model.supercontig_34.175
Capsella rubellaCarubv10015768mCarubv10002522m
Citrus clementinaCiclev10011228m
Citrus sinensisorange1.1g026638morange1.1g027057m
Cucumis sativusCucsa.337440.1
Eucalyptus grandisEucgr.A02178.1Eucgr.K01691.1Eucgr.A02178.2
Fragaria vescamrna17951.1-v1.0-hybrid
Glycine maxGlyma03g27460.5Glyma03g27460.4Glyma03g27460.2Glyma19g30450.1Glyma19g30150.1
Glyma03g00626.1Glyma03g00633.1Glyma19g30460.1Glyma03g27490.1Glyma19g30470.2
Glyma19g30145.1Glyma03g27470.1
Gossypium raimondiiGorai.002G225800.2Gorai.002G225800.1Gorai.002G225800.3
Linum usitatissimumLus10038988Lus10027276Lus10031008Lus10035405
Malus domesticaMDP0000055078MDP0000256049
Manihot esculentacassava4.1_003090m
Medicago truncatulaMedtr7g088410.1Medtr7g087890.1Medtr7g088470.1Medtr7g088440.1Medtr7g087960.1
Medtr7g088420.1Medtr7g087880.1
Mimulus guttatusmgv1a002391mmgv1a002448m
Oryza sativaLOC_Os11g03730.3LOC_Os11g03730.2LOC_Os11g03730.1LOC_Os12g03470.4LOC_Os12g03470.3
LOC_Os12g03470.2LOC_Os12g03470.1LOC_Os11g03780.2LOC_Os11g03780.1LOC_Os12g03480.1
LOC_Os12g03470.5LOC_Os03g20420.1LOC_Os07g48750.1LOC_Os03g20420.3LOC_Os03g20420.2
LOC_Os12g03530.1
Panicum virgatumPavirv00016916mPavirv00051129mPavirv00020825mPavirv00020824mPavirv00042420m
Pavirv00018090mPavirv00069322mPavirv00018295mPavirv00042419mPavirv00064991m
Pavirv00005360mPavirv00042421mPavirv00035719mPavirv00056898mPavirv00021975m
Physcomitrella patensPp1s317_21V6.1Pp1s106_48V6.2Pp1s106_48V6.1
Phaseolus vulgarisPhvul.001G115700.1Phvul.005G037800.1Phvul.001G116300.1Phvul.001G116100.1Phvul.001G116200.1
Picea abiesMA_10435925g0010
Populus trichocarpaPotri.006G029900.1Potri.006G027700.1Potri.016G025500.5Potri.016G025500.1Potri.016G025500.2
Potri.006G027700.3Potri.016G025500.4Potri.006G027700.2Potri.016G025500.3Potri.006G027700.4
Prunus persicappa002396mppa002372mppa002767m.226.432ppa002767m.226.432ppa002767m.432.629
ppa002767m.432.629
Ricinus communis30045.m000479
Setaria italicaSi009572mSi026078mSi026077mSi026076mSi026219m
Si009562mSi026072mSi029144mSi034569mSi007159m
Selaginella moellendorffii267967269745
Sorghum bicolorSb05g001900.2Sb05g001900.1Sb08g001540.1Sb05g007100.1Sb02g043530.1
Sb01g036960.1
Thellungiella halophilaThhalv10020221mThhalv10015637m
Vitis viniferaGSVIVT01025847001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)