CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10022636m
FamilyGT37
Protein PropertiesLength: 539 Molecular Weight: 61895 Isoelectric Point: 7.506
ChromosomeChromosome/Scaffold: 11 Start: 6032725 End: 6034566
Descriptionfucosyltransferase 5
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT37525080
  TTNDSKESETPRDKLIGGLLTEDFEESSCLSRYQKTLLYRKPSPYKPSEYLVSKLRSYEMLHKRCGPGTKAYKEATENLVHDDEDKASKYVGGECRYIVW
  LAGYGLGNRMLTLASAFLYALLTERIILVDQRKDVSDILCEPFPGTSWLLPLDFPLMNYTYRFNKEYPRCYGTMLNNQAINSTSIPPHLYLHNLHDSRDE
  DKMFFCEKDQSLINKVPWLVFQANVYFAPSLWFNPTFLPELTKLFPQKDTVFHHLARYLFHPTNQVWGMVTRYYQAHLSRADETLGIQIRVFRKDAGYFQ
  HVMDQIVSCTQREKLLPELATQEESKVNISNIQKLKAVIVTSLYPEYSDNLKNMFWERPSSTGEIIDVAQPSGERFQQTDKKIHDQKALAEMYLLSLTDN
  IVTSARSTFGYVSYSLGGLKPWLLYQPTGEITPDPACVRSTSMEPCYLTPPSHGCEA
Full Sequence
Protein Sequence     Length: 539     Download
MYHKFQISSK VYRALDLKMK MLIAVAFSCL LIGSIVLLSF SNNFNNRLLN ATTNDSKESE    60
TPRDKLIGGL LTEDFEESSC LSRYQKTLLY RKPSPYKPSE YLVSKLRSYE MLHKRCGPGT    120
KAYKEATENL VHDDEDKASK YVGGECRYIV WLAGYGLGNR MLTLASAFLY ALLTERIILV    180
DQRKDVSDIL CEPFPGTSWL LPLDFPLMNY TYRFNKEYPR CYGTMLNNQA INSTSIPPHL    240
YLHNLHDSRD EDKMFFCEKD QSLINKVPWL VFQANVYFAP SLWFNPTFLP ELTKLFPQKD    300
TVFHHLARYL FHPTNQVWGM VTRYYQAHLS RADETLGIQI RVFRKDAGYF QHVMDQIVSC    360
TQREKLLPEL ATQEESKVNI SNIQKLKAVI VTSLYPEYSD NLKNMFWERP SSTGEIIDVA    420
QPSGERFQQT DKKIHDQKAL AEMYLLSLTD NIVTSARSTF GYVSYSLGGL KPWLLYQPTG    480
EITPDPACVR STSMEPCYLT PPSHGCEADW GKNSGKIVPF LKHCEDIMYG GLKLYDEV*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR00348hsdR0.00826532864+
cd11548NodZ_like2.0e-9156469324+
pfam03254XG_FTase051508461+
Gene Ontology
GO TermDescription
GO:0008107galactoside 2-alpha-L-fucosyltransferase activity
GO:0016020membrane
GO:0042546cell wall biogenesis
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAL50624.10195371514AF417475_1 fucosyltransferase-like protein FUT5 [Arabidopsis thaliana]
RefSeqNP_172860.104253824519FUT6 (FUCOSYLTRANSFERASE 6); fucosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
RefSeqNP_179139.1015371532FUT5; fucosyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Swiss-ProtQ9SJP60195371513FUT10_ARATH RecName: Full=Putative fucosyltransferase 10; Short=AtFUT10
Swiss-ProtQ9XI80015381537FUT6_ARATH RecName: Full=Fucosyltransferase 6; Short=AtFUT6
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3ho5_B0.003157247161239H Chain H, Crystal Structure Of Hedgehog-interacting Protein (hhip) And Sonic Hedgehog (shh) Complex
PDB3ho5_A0.003157247161239H Chain H, Crystal Structure Of Hedgehog-interacting Protein (hhip) And Sonic Hedgehog (shh) Complex
PDB3ho4_B0.003157247161239A Chain A, Crystal Structure Of Hedgehog-Interacting Protein (Hhip)
PDB3ho4_A0.003157247161239A Chain A, Crystal Structure Of Hedgehog-Interacting Protein (Hhip)
PDB3ho3_A0.003157247161239A Chain A, Crystal Structure Of Hedgehog-interacting Protein (hhip)
Transmembrane Domains
StartEnd
2140
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES90270529812970
ES90332728912880
ES9006312731684400
EV1248662352164500
ES900631264324570.13
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00710.1Aquca_002_00674.2Aquca_002_00674.1Aquca_002_00675.1Aquca_002_00677.1
Aquca_024_00009.1Aquca_006_00124.1Aquca_002_00676.1.65.313Aquca_002_00676.1.65.313Aquca_002_00676.1.313.480
Aquca_002_00676.1.313.480
Arabidopsis lyrata484227312409.55.508312409.55.508484226879690
874761480406877549879689
Arabidopsis thalianaAT2G03220.1AT1G14100.1AT2G03210.1AT1G14070.1AT1G14080.1
AT2G15370.1AT2G15390.2AT2G15390.1AT1G74420.2AT1G74420.1
AT2G15350.1AT1G14110.1.33.335AT1G14110.1.33.335AT1G14110.1.336.446AT1G14110.1.336.446
Brachypodium distachyonBradi3g58030.1Bradi1g46010.1Bradi1g46020.1Bradi3g58040.1Bradi4g32407.1
Bradi2g40470.1Bradi3g58067.1Bradi1g46050.1Bradi1g46030.1Bradi5g11770.1
Bradi1g46037.1Bradi4g32160.1Bradi1g46002.1Bradi4g13697.1Bradi3g10230.1
Bradi3g58050.1
Brassica rapaBra024785Bra019679Bra019680Bra024786Bra016712
Bra016709Bra026858Bra026859Bra019685Bra016711
Bra015217Bra026861.214.659Bra026861.214.659Bra039838Bra019681
Bra019683.173.573Bra019683.173.573Bra026860Bra003802.296.542Bra003802.296.542
Bra016710.192.381Bra016710.192.381Bra016710.35.189Bra016710.35.189Bra003802.141.280
Bra003802.141.280Bra026861.47.184Bra026861.47.184Bra019683.64.173Bra019683.64.173
Carica papayaevm.model.supercontig_341.1evm.model.supercontig_1.58evm.model.supercontig_57.37
Capsella rubellaCarubv10016945mCarubv10008772mCarubv10011805m.34.489Carubv10011805m.34.489Carubv10011805m.34.489
Carubv10016438mCarubv10019159mCarubv10013337mCarubv10008907mCarubv10011805m.506.770
Carubv10011805m.506.770Carubv10011805m.506.770Carubv10020557mCarubv10011805m.771.920Carubv10011805m.771.920
Carubv10011805m.771.920
Citrus clementinaCiclev10000822mCiclev10000784mCiclev10019479mCiclev10000769mCiclev10033742m.202.352
Ciclev10033742m.202.352Ciclev10033742m.82.202Ciclev10033742m.82.202Ciclev10003626m.196.297Ciclev10003626m.196.297
Citrus sinensisorange1.1g009398morange1.1g009137morange1.1g039620morange1.1g008917morange1.1g010030m
orange1.1g019688morange1.1g046759m.200.367orange1.1g046759m.200.367orange1.1g046759m.82.201orange1.1g046759m.82.201
Cucumis sativusCucsa.284850.1Cucsa.112900.1Cucsa.179880.1
Eucalyptus grandisEucgr.B03204.1Eucgr.B00531.2Eucgr.B00531.1
Fragaria vescamrna26047.1-v1.0-hybrid
Glycine maxGlyma06g21090.1Glyma04g33170.1Glyma05g00920.1Glyma13g44770.9Glyma13g44770.8
Glyma13g44770.7Glyma13g44770.6Glyma13g44770.5Glyma13g44770.4Glyma13g44770.11
Glyma13g44770.10Glyma08g23480.1Glyma13g44770.15Glyma13g44770.14Glyma13g44770.13
Glyma13g44770.12Glyma07g02550.2Glyma07g02540.2Glyma07g02540.1Glyma17g10980.1
Glyma13g44760.1Glyma08g23470.2
Gossypium raimondiiGorai.013G088600.1Gorai.001G072600.2Gorai.001G072600.1
Linum usitatissimumLus10036776Lus10008696Lus10041642Lus10041641Lus10029049
Lus10037152Lus10026128Lus10024076Lus10041644Lus10013549
Lus10012571Lus10041645Lus10008693Lus10026125Lus10008691
Lus10024077Lus10024079
Malus domesticaMDP0000230681MDP0000176324MDP0000529420MDP0000204702MDP0000668674
MDP0000300083
Manihot esculentacassava4.1_021940mcassava4.1_023646mcassava4.1_025117mcassava4.1_004330mcassava4.1_004355m
cassava4.1_004412mcassava4.1_004549mcassava4.1_004338m
Medicago truncatulaMedtr1g090430.1AC233556_13.1Medtr4g007220.1Medtr2g020730.1Medtr4g007380.1
Medtr4g007360.1
Mimulus guttatusmgv1a003737m
Oryza sativaLOC_Os02g52640.1LOC_Os02g52610.1LOC_Os02g52610.2LOC_Os06g10960.1LOC_Os02g52630.1
LOC_Os06g10950.1LOC_Os06g10970.1LOC_Os02g52560.1LOC_Os04g37640.1LOC_Os04g37650.1
LOC_Os06g10930.1LOC_Os02g52590.1LOC_Os06g10980.1LOC_Os06g10910.1LOC_Os09g28460.1
LOC_Os08g24750.1LOC_Os06g10920.1LOC_Os02g17534.1LOC_Os02g17600.1LOC_Os02g25630.1
Panicum virgatumPavirv00070548mPavirv00051908mPavirv00022554mPavirv00065240mPavirv00003029m
Pavirv00050380mPavirv00010182mPavirv00042819mPavirv00022553mPavirv00056797m
Pavirv00051909mPavirv00044824mPavirv00015944mPavirv00041002mPavirv00051213m
Pavirv00040276mPavirv00068125mPavirv00007429mPavirv00000679mPavirv00064479m
Pavirv00019978mPavirv00015945mPavirv00061706mPavirv00010181mPavirv00034186m
Pavirv00004957mPavirv00041951mPavirv00007564mPavirv00053047mPavirv00026147m.124.422
Pavirv00026147m.124.422Pavirv00026388m
Physcomitrella patensPp1s352_42V6.1Pp1s126_53V6.1Pp1s177_107V6.1Pp1s177_109V6.1Pp1s38_405V6.1
Pp1s28_329V6.1Pp1s92_101V6.1Pp1s52_48V6.1Pp1s75_26V6.1Pp1s115_139V6.1
Pp1s115_139V6.2Pp1s199_19V6.1.228.510Pp1s199_19V6.1.228.510Pp1s71_58V6.1Pp1s199_19V6.1.107.211
Pp1s199_19V6.1.107.211
Phaseolus vulgarisPhvul.009G185700.1Phvul.005G182600.1Phvul.010G162100.1Phvul.010G162000.1Phvul.010G161900.1
Phvul.010G161900.2Phvul.003G188900.1
Picea abiesMA_38751g0010MA_478295g0010MA_402760g0010
Populus trichocarpaPotri.001G034100.1Potri.003G191200.1Potri.003G191500.1Potri.003G191300.2Potri.001G033800.1
Potri.008G090000.1Potri.003G191300.1Potri.003G191300.3Potri.003G191300.4Potri.001G034000.1
Prunus persicappa003476mppa003874m
Ricinus communis28333.m00057928333.m00058129686.m00087429686.m00087629813.m001528
29686.m00087529686.m00087730138.m004050.273.51930138.m004050.273.51928333.m000580
30138.m004050.89.27530138.m004050.89.275
Setaria italicaSi019396mSi016945mSi008446mSi008440mSi016741m
Si006115mSi019763mSi007978mSi008778mSi019585m
Si008425mSi012369mSi012302mSi009710mSi007932m
Si031974mSi008742mSi029404mSi016775mSi029293m
Si017473m
Selaginella moellendorffii9176197987416793441628412985
444560430640.63.271430640.63.271430640.280.409430640.280.409
427741.233.362427741.233.362427741.63.183427741.63.183420100
Sorghum bicolorSb04g034120.1Sb04g034100.1Sb10g007140.1Sb04g034070.1Sb10g007120.1
Sb04g034110.1Sb04g034080.1Sb02g026640.1Sb04g010430.1Sb10g007110.1
Sb04g010420.1Sb06g018250.1Sb04g010630.1Sb10g007150.1Sb02g001790.1
Sb08g004580.1Sb02g001803.1Sb10g007130.1.70.296Sb10g007130.1.70.296Sb10g007130.1.329.513
Sb10g007130.1.329.513
Thellungiella halophilaThhalv10003931mThhalv10009330mThhalv10009872mThhalv10007297mThhalv10009357m
Thhalv10009946mThhalv10009405mThhalv10005557mThhalv10009670mThhalv10018409m
Thhalv10000629m
Vitis viniferaGSVIVT01003228001.70.337GSVIVT01003228001.70.337GSVIVT01007978001.81.321GSVIVT01007978001.81.321GSVIVT01007978001.323.487
GSVIVT01007978001.323.487GSVIVT01003228001.337.442GSVIVT01003228001.337.442
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)