y PlantCAZyme

CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10024392m
FamilyGH35
Protein PropertiesLength: 845 Molecular Weight: 95443.4 Isoelectric Point: 9.7892
ChromosomeChromosome/Scaffold: 1 Start: 2148545 End: 2152854
Descriptionbeta-galactosidase 11
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH35483520
  LIIDGKRELLYSGSIHYPRSTPEMWPHIIKRAKQGGLNTIQTYVFWNVHEPEQGKFNFSGRADLVKFIKLIEKNGMYVTLRLGPFIQAEWTHGGLPYWLR
  EVPGIFFRTDNEAFKEHTERYVRMILDKMKEEKLFASQGGPIILGQIENEYSAVQRAYKQDGLNYIKWASKLVDSMNLGIPWVMCKQNDAPDPMINACNG
  RHCGDTFPGPNKEYKPSLWTENWTTQFRVFGDPPTQRSVEDIAFSVARFFSKNGSHVNYYMYHGGTNFGRTSAHYVTTRYYDDAPLDEFGLEKEPKYGHL
  KHLHN
Full Sequence
Protein Sequence     Length: 845     Download
MRKHSLDRWL LTAVFVVILS SSSLIAAKKD VKKKKKINKE VTYDGTSLII DGKRELLYSG    60
SIHYPRSTPE MWPHIIKRAK QGGLNTIQTY VFWNVHEPEQ GKFNFSGRAD LVKFIKLIEK    120
NGMYVTLRLG PFIQAEWTHG GLPYWLREVP GIFFRTDNEA FKEHTERYVR MILDKMKEEK    180
LFASQGGPII LGQIENEYSA VQRAYKQDGL NYIKWASKLV DSMNLGIPWV MCKQNDAPDP    240
MINACNGRHC GDTFPGPNKE YKPSLWTENW TTQFRVFGDP PTQRSVEDIA FSVARFFSKN    300
GSHVNYYMYH GGTNFGRTSA HYVTTRYYDD APLDEFGLEK EPKYGHLKHL HNALNLCKKP    360
LLWGQPRTEK PGKDTEIRYY EQPGTKSCAA FLANNNTEAA ETIKFRGKEY VIAPRSISIL    420
PDCKTVVYNT AQIVSQHTAR NFMKSKKANK KFDFQVFTEA LPSKLQGDSY IPVELYGLTK    480
DKTDYGWYTT SFKVHENHLP KKGVKSVVRI ASLGHALHVW LNGEYIGNGH GSHEEKSFVF    540
QKPVTLKAGE NHLIMLGVLT GFPDSGSYME HRYTGPRSVS ILGLTSGTLD LTESSKWGNK    600
VGMEGERLGI HTEKGLKKVK WQKFSGKAPG LTWYQTYFDA PESQNAAAIR MSGMGKGLIW    660
VNGEGVGRYW MSFLSPLGQP TQIEYHIPRS FLKPKKNLLV IFEEEPNVKP ELIDFVIVNR    720
DTVCSYVGEN YTPSVRHWTR KQDQVQAITD NVSLTATLKC SGTKKIAAVE FASFGNPIGV    780
CGNFTLGTCN APVSKQVVEK HCLGKAECVI PVNKSTFQQD KKDSCKNFVK TLAVQVKCGR    840
GKKN*                                                                900
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam02449Glyco_hydro_427.0e-1069198149+
pfam02140Gal_Lectin2.0e-1675883885+
COG1874LacA9.0e-2341198165+
pfam01301Glyco_hydro_358.0e-15247354322+
PLN03059PLN03059041838826+
Gene Ontology
GO TermDescription
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005529Interacting selectively and non-covalently with any carbohydrate, which includes monosaccharides, oligosaccharides and polysaccharides as well as substances derived from monosaccharides by reduction of the carbonyl group (alditols), by oxidation of one or more hydroxy groups to afford the corresponding aldehydes, ketones, or carboxylic acids, or by replacement of one or more hydroxy group(s) by a hydrogen atom. Cyclitols are generally not regarded as carbohydrates." [CHEBI:16646, GOC:mah]
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAD24606.104484431832putative beta-galactosidase [Arabidopsis thaliana]
EMBLCAA17766.103884451831beta-galactosidase-like protein [Arabidopsis thaliana]
RefSeqNP_179264.204084443848BGAL13; beta-galactosidase [Arabidopsis thaliana]
RefSeqNP_567973.1018441845BGAL11 (beta-galactosidase 11); beta-galactosidase [Arabidopsis thaliana]
Swiss-ProtQ9SCU8018387837BGL14_ARATH RecName: Full=Beta-galactosidase 14; Short=Lactase 14; Flags: Precursor
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3d3a_A1.99965e-424635013325A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_D5e-364035010330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
PDB3thd_C5e-364035010330A Chain A, Crystal Structure Of A Beta-Galactosidase From Bacteroides Thetaiotaomicron
Transmembrane Domains
StartEnd
927
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778160693407040
CX1900452785388150
GR4538012611333930
GR4625472561964510
GR4605912531423940
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00260.2Aquca_014_00260.1Aquca_006_00263.3Aquca_006_00263.2Aquca_006_00263.1
Arabidopsis lyrata496568476906491156480556912308
Arabidopsis thalianaAT5G63800.1AT1G77410.1AT4G38590.2AT4G38590.1AT2G16730.1
AT4G35010.1
Brachypodium distachyonBradi2g56597.1Bradi3g42330.1Bradi4g36517.1Bradi2g24670.1
Brassica rapaBra029200Bra011577Bra017687Bra013052Bra001991
Bra033571Bra024237
Carica papayaevm.model.supercontig_37.29evm.model.supercontig_64.121evm.model.supercontig_64.120evm.model.supercontig_37.144
Capsella rubellaCarubv10028665mCarubv10022317mCarubv10007813mCarubv10006573mCarubv10016129m
Citrus clementinaCiclev10000420mCiclev10004034mCiclev10003478mCiclev10023501mCiclev10026929m
Ciclev10030124m
Citrus sinensisorange1.1g003612morange1.1g041957morange1.1g045037morange1.1g035496morange1.1g006326m
orange1.1g006301m
Cucumis sativusCucsa.060550.1Cucsa.370570.1
Eucalyptus grandisEucgr.H05090.1Eucgr.G01775.1Eucgr.I02332.1Eucgr.I01412.1
Fragaria vescamrna24180.1-v1.0-hybridmrna11229.1-v1.0-hybridmrna06055.1-v1.0-hybridmrna07651.1-v1.0-hybrid
Glycine maxGlyma06g16430.1Glyma04g38580.3Glyma08g00470.1Glyma04g38580.1Glyma04g38580.2
Glyma08g00470.2Glyma04g42620.3Glyma06g12150.1Glyma04g42620.2Glyma06g12150.2
Glyma12g03650.1Glyma12g03650.2Glyma04g00520.1Glyma11g11500.1
Gossypium raimondiiGorai.012G037700.1Gorai.010G052200.1Gorai.010G052300.1Gorai.009G265200.1Gorai.002G197200.3
Gorai.002G197200.2Gorai.002G197200.1Gorai.002G197100.1Gorai.008G036000.1
Linum usitatissimumLus10020875.306.587Lus10020875.306.587Lus10028538Lus10033502Lus10033427
Lus10018138Lus10008259Lus10033500Lus10020875.38.306Lus10020875.38.306
Lus10014126Lus10019784Lus10005071Lus10027844Lus10027843
Malus domesticaMDP0000202466MDP0000316304MDP0000243780MDP0000206284MDP0000322037
MDP0000320504MDP0000225967MDP0000222132MDP0000863563
Manihot esculentacassava4.1_033913mcassava4.1_025630mcassava4.1_023088mcassava4.1_031197mcassava4.1_023181m
cassava4.1_023219m
Medicago truncatulaMedtr3g096910.1Medtr8g095690.1Medtr3g088520.1Medtr3g117840.1Medtr4g073290.1
Mimulus guttatusmgv1a018569mmgv1a001345m
Oryza sativaLOC_Os05g35360.1LOC_Os08g43570.1LOC_Os09g36810.1
Panicum virgatumPavirv00062685mPavirv00037142mPavirv00063105mPavirv00038064mPavirv00037143m
Pavirv00021342mPavirv00010263mPavirv00038026mPavirv00010484m
Phaseolus vulgarisPhvul.009G153000.1Phvul.009G127500.1Phvul.009G119400.1Phvul.L007600.1Phvul.009G119600.1
Phvul.011G035300.1
Picea abiesMA_65469g0020
Populus trichocarpaPotri.005G069200.2Potri.005G069200.1Potri.005G180600.1Potri.002G080700.1Potri.013G105100.1
Potri.009G134400.1Potri.004G174800.1
Prunus persicappa001308mppa019277mppa026900mppa020492m
Ricinus communis29648.m00200830074.m001370
Setaria italicaSi004751mSi021244mSi024535mSi013260mSi028962m
Sorghum bicolorSb09g021140.1Sb07g024870.1Sb02g031260.1
Thellungiella halophilaThhalv10018129mThhalv10005464mThhalv10022550m
Vitis viniferaGSVIVT01022353001GSVIVT01008835001GSVIVT01008834001GSVIVT01024031001
Zea maysAC234152.1_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)