y PlantCAZyme

CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10024684m
FamilyGH37
Protein PropertiesLength: 624 Molecular Weight: 70847.1 Isoelectric Point: 5.2262
ChromosomeChromosome/Scaffold: 1 Start: 6836848 End: 6840099
Descriptiontrehalase 1
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH37986120
  PDPKSYIDLSLKLPHDLSTVETAFDDLTSESRDLSVPVDKLEKFVDQYFDGAGEDLVHHEPEDFVSDPSGFLLNVENEQVREWAREVHGLWTTLSRRVSD
  AVRESPERHTLLQLPEPVIIPGSRFREVYYWDSYWVIKGLLTSKMHTTAKGLVTNLMSLVETYGYALNGARAYYTNRSQPPLLSSMVYEIYNVTKDEELV
  KKAIPVLLKEYDFWNSGKHKVVIRDASGYDHILSRYYAMWNMPRPESSVFDQESASGFSSTLEKQRFHRDIATAAESGCDFSTRWMRDPPNFTTMATTSV
  VPVDLNVFLFKMELDIAFMMEVSGDENGRERFVKASEARVKAFETVFWNEKAGQWLDYWLSSNGDEPEIWKAESQNTNVFASNFAPIWINSFHLDENLVK
  KVLKALKNSGLIAPAGILTSLTNSGQQWDSPNGWAPQQEMIVTGLARSGLKEAKEMAEEIARRWIRSSYRVYKTSGTIHEKLNVSEFGQYGGGGEYKPQT
  GFGWSNGVILAFLEE
Full Sequence
Protein Sequence     Length: 624     Download
MNLRKHNPND PISTHLSSLS FPYEFLHSFP LFASILPQTK RLTPLFLFFF LCFSFVTSMA    60
VLDTNSDSGP VIPTTPLVTF LQRVQLTALR SYPKTLTPDP KSYIDLSLKL PHDLSTVETA    120
FDDLTSESRD LSVPVDKLEK FVDQYFDGAG EDLVHHEPED FVSDPSGFLL NVENEQVREW    180
AREVHGLWTT LSRRVSDAVR ESPERHTLLQ LPEPVIIPGS RFREVYYWDS YWVIKGLLTS    240
KMHTTAKGLV TNLMSLVETY GYALNGARAY YTNRSQPPLL SSMVYEIYNV TKDEELVKKA    300
IPVLLKEYDF WNSGKHKVVI RDASGYDHIL SRYYAMWNMP RPESSVFDQE SASGFSSTLE    360
KQRFHRDIAT AAESGCDFST RWMRDPPNFT TMATTSVVPV DLNVFLFKME LDIAFMMEVS    420
GDENGRERFV KASEARVKAF ETVFWNEKAG QWLDYWLSSN GDEPEIWKAE SQNTNVFASN    480
FAPIWINSFH LDENLVKKVL KALKNSGLIA PAGILTSLTN SGQQWDSPNG WAPQQEMIVT    540
GLARSGLKEA KEMAEEIARR WIRSSYRVYK TSGTIHEKLN VSEFGQYGGG GEYKPQTGFG    600
WSNGVILAFL EEFGWPSDLS IEP*                                           660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK13270treF7.0e-83138616497+
PRK13271treA9.0e-88173611447+
COG1626TreA3.0e-90186614442+
PLN02567PLN02567071623556+
pfam01204Trehalase098614524+
Gene Ontology
GO TermDescription
GO:0004555alpha,alpha-trehalase activity
GO:0005991trehalose metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAB63620.10636225556trehalase precusor isolog [Arabidopsis thaliana]
GenBankAAD22970.10716229556AF124148_1 trehalase 1 GMTRE1 [Glycine max]
GenBankAAF22127.10636225565AF126425_1 trehalase [Arabidopsis thaliana]
RefSeqNP_194135.1066227625TRE1 (TREHALASE 1); alpha,alpha-trehalase/ trehalase [Arabidopsis thaliana]
RefSeqXP_002263698.10596221563PREDICTED: hypothetical protein [Vitis vinifera]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2wyn_D017361181500A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2wyn_C017361181500A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2wyn_B017361181500A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2wyn_A017361181500A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
PDB2jjb_D017361181500A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig
Transmembrane Domains
StartEnd
4562
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL5887652941033960
ES9056312792345120
GR4452482691404080
EY9334822331924240
GR4478022322314620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_037_00232.1Aquca_037_00231.2Aquca_037_00231.1
Arabidopsis lyrata914188
Arabidopsis thalianaAT4G24040.1
Brachypodium distachyonBradi3g31410.3Bradi3g31410.2Bradi3g31410.1
Brassica rapaBra013756Bra019249
Carica papayaevm.model.supercontig_15.13
Capsella rubellaCarubv10006565m
Chlamydomonas reinhardtiiCre03.g195600.t1.2.34.224Cre03.g195600.t1.2.34.224Cre03.g195600.t1.2.267.650Cre03.g195600.t1.2.267.650
Citrus clementinaCiclev10023271mCiclev10033306mCiclev10001132mCiclev10001012mCiclev10001134m
Ciclev10000621mCiclev10000674m
Citrus sinensisorange1.1g041103m.84.216orange1.1g037772m.219.456orange1.1g037772m.219.456orange1.1g047407morange1.1g041103m.217.446
orange1.1g041103m.217.446orange1.1g037772m.86.219orange1.1g037772m.86.219orange1.1g041103m.84.216
Cucumis sativusCucsa.303880.1
Eucalyptus grandisEucgr.E01027.1Eucgr.E01027.2
Fragaria vescamrna25101.1-v1.0-hybrid
Glycine maxGlyma05g36580.2Glyma05g36580.1
Gossypium raimondiiGorai.003G075200.1Gorai.007G020500.2Gorai.007G020500.1
Linum usitatissimumLus10023035Lus10032434Lus10023034Lus10032435
Malus domesticaMDP0000315187.328.541MDP0000235673.82.325MDP0000315187.82.325MDP0000315187.82.325MDP0000235673.82.325
MDP0000235673.328.541MDP0000315187.328.541MDP0000235673.328.541
Manihot esculentacassava4.1_015916mcassava4.1_004491mcassava4.1_023202m
Mimulus guttatusmgv1a003260m
Oryza sativaLOC_Os10g37660.1
Panicum virgatumPavirv00009281mPavirv00064436mPavirv00062867mPavirv00064435m
Physcomitrella patensPp1s196_77V6.1Pp1s194_104V6.3Pp1s116_30V6.1Pp1s194_104V6.2Pp1s194_104V6.1
Pp1s137_159V6.1
Phaseolus vulgarisPhvul.002G301500.2Phvul.002G301500.1
Picea abiesMA_31368g0020MA_31368g0010
Populus trichocarpaPotri.001G087100.1Potri.003G144000.1Potri.006G068300.1Potri.003G143900.1Potri.001G087100.2
Prunus persicappa003514m
Ricinus communis28842.m00094530068.m002541
Setaria italicaSi034760m
Selaginella moellendorffii90006177119156751109304
Sorghum bicolorSb01g031280.1
Vitis viniferaGSVIVT01019610001
Volvox carteriVocar20003462m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny