CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10025208m
FamilyGT13
Protein PropertiesLength: 445 Molecular Weight: 51742.1 Isoelectric Point: 8.3491
ChromosomeChromosome/Scaffold: 1 Start: 52570 End: 56325
Descriptionalpha-1,3-mannosyl-glycoprotein beta-1,2-N-acetylglucosaminyltransferase, putative
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT13234360
  QMRLFQTQSHYADRLGSAIESENHCTSQMRALIDEVSIKQSRIVALEDMRNRQDQELVQLKDLIQTFGRKGLAKLVEGGQTPLAAVVIMACSRADYLERT
  VESVLKYQSPVASKYPLFISQDGSNQAVKSKALSYNQLTYMQHLDFEPVVTERPGELIAYYKIARHYKWALDQLFYKYKFNRVIILEDDMEIAPDFFDYF
  EAAASLMDRDRTIMAASSWNDNGQKQFVHDPYALYRSDFFPGLGWMLKRTTWDELSPKWPKAYWDDWLRLKENHKGRQFVRPEVCRTYNFGEHGSSLGQF
  FSQYLEPIKLNDVKVDWKAIDLGYLTEGNYTEYFSDLVRQAQPIQGSDLVLKAKNIKGDVRIRYKDQAEFERIAGEFGIFEEWKDGVPRTAYRGVVVFRI
  QTTRRVFLVGPDSV
Full Sequence
Protein Sequence     Length: 445     Download
MARISFDFRF LLIPAAFMFI YLQMRLFQTQ SHYADRLGSA IESENHCTSQ MRALIDEVSI    60
KQSRIVALED MRNRQDQELV QLKDLIQTFG RKGLAKLVEG GQTPLAAVVI MACSRADYLE    120
RTVESVLKYQ SPVASKYPLF ISQDGSNQAV KSKALSYNQL TYMQHLDFEP VVTERPGELI    180
AYYKIARHYK WALDQLFYKY KFNRVIILED DMEIAPDFFD YFEAAASLMD RDRTIMAASS    240
WNDNGQKQFV HDPYALYRSD FFPGLGWMLK RTTWDELSPK WPKAYWDDWL RLKENHKGRQ    300
FVRPEVCRTY NFGEHGSSLG QFFSQYLEPI KLNDVKVDWK AIDLGYLTEG NYTEYFSDLV    360
RQAQPIQGSD LVLKAKNIKG DVRIRYKDQA EFERIAGEFG IFEEWKDGVP RTAYRGVVVF    420
RIQTTRRVFL VGPDSVVQLG IRKS* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam13641Glyco_tranf_2_30.006107327239+
cd00761Glyco_tranf_GTA_type0.003108303199+
cd02514GT13_GLCNAC-TI5.0e-178106435335+
pfam03071GNT-I013442436+
Gene Ontology
GO TermDescription
GO:0000139Golgi membrane
GO:0003827alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase activity
GO:0006487protein N-linked glycosylation
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAB37480.1014411454glycosyltransferase like protein (fragment) [Arabidopsis thaliana]
EMBLCAB37564.1014441457glycosyltransferase like protein [Arabidopsis thaliana]
EMBLCAC80700.1014441444N-acetylglucosaminyltransferase I [Arabidopsis thaliana]
EMBLCBI29533.1014411438unnamed protein product [Vitis vinifera]
RefSeqNP_195537.2014441444CGL1 (COMPLEX GLYCAN LESS 1); alpha-1,3-mannosylglycoprotein 2-beta-N-acetylglucosaminyltransferase/ protein N-acetylglucosaminyltransferase/ transferase, transferring glycosyl groups [Arabidopsis thaliana]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1fo8_A01084356334A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2apc_A01084355333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2am5_A01084355333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2am4_A01084355333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I
PDB2am3_A01084355333A Chain A, Crystal Structure Of N-Acetylglucosaminyltransferase I In Complex With Udp-Glucose
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX035232286363210
BX83986232813280
EH7311532901524410
GO802527324293510
ES8416563041284290
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00911.3Aquca_007_00911.4Aquca_007_00911.2Aquca_007_00911.1Aquca_007_00911.5
Arabidopsis lyrata912565490588
Arabidopsis thalianaAT4G38240.1AT4G38240.2AT4G38240.3
Brachypodium distachyonBradi3g60820.3Bradi3g60820.1Bradi3g60820.2
Brassica rapaBra033557
Carica papayaevm.TU.contig_28580.1.22.235evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.235.387evm.TU.contig_28580.1.22.235
Capsella rubellaCarubv10007540m
Citrus clementinaCiclev10028418m
Citrus sinensisorange1.1g019888morange1.1g012912morange1.1g012941m
Cucumis sativusCucsa.099720.1Cucsa.099720.2
Eucalyptus grandisEucgr.L00584.1Eucgr.L00583.1Eucgr.H04987.1Eucgr.H04987.2Eucgr.H04989.3
Eucgr.H04989.2Eucgr.H04989.4Eucgr.H04989.1
Fragaria vescamrna17328.1-v1.0-hybrid
Glycine maxGlyma04g00200.1Glyma06g00230.1
Gossypium raimondiiGorai.008G014000.2Gorai.008G014000.3Gorai.008G014000.1
Linum usitatissimumLus10022994Lus10001389
Malus domesticaMDP0000173465.283.435MDP0000170967.230.351MDP0000170967.22.209MDP0000170967.22.209MDP0000173465.283.435
MDP0000173465.22.268MDP0000173465.22.268MDP0000170967.230.351
Manihot esculentacassava4.1_024783m
Medicago truncatulaMedtr3g118520.1Medtr3g118520.2Medtr3g118520.3
Mimulus guttatusmgv1a006517mmgv1a006750m
Oryza sativaLOC_Os02g58590.1.304.426LOC_Os02g58590.1.304.426LOC_Os02g58590.1.22.283LOC_Os02g58590.1.22.283
Panicum virgatumPavirv00053907mPavirv00020030m
Physcomitrella patensPp1s100_54V6.1Pp1s246_61V6.1
Phaseolus vulgarisPhvul.009G115600.1
Picea abiesMA_901813g0010
Populus trichocarpaPotri.009G168000.2Potri.009G168000.1Potri.009G168000.4Potri.004G206900.3Potri.004G206900.1
Potri.004G206900.2Potri.009G168000.3
Prunus persicappa006221m
Ricinus communis29675.m000398.22.23129675.m000398.232.34829675.m000398.232.34829675.m000398.22.231
Setaria italicaSi006441mSi006440m
Selaginella moellendorffii268301
Sorghum bicolorSb08g003660.1
Thellungiella halophilaThhalv10025211mThhalv10025250m
Vitis viniferaGSVIVT01002028001GSVIVT01002907001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny