CAZyme Information

Basic Information
SpeciesThellungiella halophila
Cazyme IDThhalv10028329m
FamilyAA2
Protein PropertiesLength: 190 Molecular Weight: 21147.1 Isoelectric Point: 10.3215
ChromosomeChromosome/Scaffold: 14 Start: 1854324 End: 1855151
DescriptionPeroxidase superfamily protein
View CDS
External Links
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA261747.4e-25
  GPTWEVPKGRKDGRISKAIETRQLPAPTFNISQLQQSFGQRGLSMHDLVVLSGGHTLGFAHCSSFQNRIHNFNLQKQVDPTLNPSFAASLNVICPAHNKV
  KNAGATMDATTTYFDNVYYKMLMQGQSLFSFDQALLTTPSSKKLVAKYASSMEEYERAFVKSIIKMSSI
Full Sequence
Protein Sequence     Length: 190     Download
NPDRYGPTWE VPKGRKDGRI SKAIETRQLP APTFNISQLQ QSFGQRGLSM HDLVVLSGGH    60
TLGFAHCSSF QNRIHNFNLQ KQVDPTLNPS FAASLNVICP AHNKVKNAGA TMDATTTYFD    120
NVYYKMLMQG QSLFSFDQAL LTTPSSKKLV AKYASSMEEY ERAFVKSIIK MSSISGNGKE    180
VRHNCRRVR* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00141peroxidase0.00812515632+
cd00691ascorbate_peroxidase7.0e-122172179+
pfam00141peroxidase7.0e-1966156+
PLN03030PLN030303.0e-346185188+
cd00693secretory_peroxidase1.0e-826188187+
Gene Ontology
GO TermDescription
GO:0004601peroxidase activity
GO:0006979response to oxidative stress
GO:0020037heme binding
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI18935.106189138320unnamed protein product [Vitis vinifera]
RefSeqNP_199033.106189134317peroxidase 64 (PER64) (P64) (PRXR4) [Arabidopsis thaliana]
RefSeqXP_002285892.106189134316PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002300689.106189135317predicted protein [Populus trichocarpa]
RefSeqXP_002510587.106188134317Peroxidase 64 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3hdl_A5e-398188116302A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree
PDB1qgj_B1e-336188111298A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1qgj_A1e-336188111298A Chain A, Arabidopsis Thaliana Peroxidase N
PDB1fhf_C2e-336188114302A Chain A, The Structure Of Soybean Peroxidase
PDB1fhf_B2e-336188114302A Chain A, The Structure Of Soybean Peroxidase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EX08303018561900
EH41914018381900
EX08513718561900
DK572081167241900
DN49097218561900
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_003_00391.1Aquca_037_00288.1Aquca_003_00389.1Aquca_035_00197.1Aquca_003_00386.1
Aquca_003_00388.1Aquca_075_00004.1Aquca_047_00045.1Aquca_026_00115.1Aquca_037_00288.2
Aquca_015_00005.1Aquca_047_00046.1Aquca_017_00327.1Aquca_017_00324.1Aquca_007_00290.1
Aquca_026_00114.1Aquca_003_00387.1Aquca_075_00004.2
Arabidopsis lyrata495255913079917590896142878690
470522887707470523898628911467
325975909489345680
Arabidopsis thalianaAT5G51890.1AT4G33420.1AT5G42180.1AT3G01190.1AT5G15180.1
AT1G05260.1AT3G21770.1AT4G11290.1AT1G05250.1AT1G05240.1
AT2G39040.1
Brachypodium distachyonBradi2g12228.1Bradi2g34717.1Bradi2g12170.1Bradi2g12192.1Bradi2g12180.1
Bradi3g60880.1Bradi2g37000.1Bradi2g13190.1Bradi1g77140.1Bradi1g77130.1
Bradi3g32130.1Bradi2g37020.1Bradi1g42900.1Bradi1g15600.1Bradi2g37010.1
Bradi5g27687.1Bradi2g20830.1Bradi2g20840.1Bradi2g20850.1Bradi1g61530.1
Bradi2g11307.1Bradi2g11300.1Bradi1g61540.1Bradi1g59520.1Bradi5g22650.1
Bradi3g04717.1Bradi1g32870.1Bradi1g44790.1Bradi1g59550.1Bradi1g44800.1
Bradi2g20820.1Bradi1g61550.1Bradi2g11295.1Bradi4g40190.1Bradi2g37040.1
Bradi1g20027.1Bradi1g19980.1Bradi2g10150.1Bradi4g05980.1Bradi1g59537.1
Bradi2g52077.1Bradi3g55850.1Bradi2g37067.1Bradi2g37060.1Bradi2g37047.1
Bradi2g11320.1Bradi2g38660.1Bradi2g38690.1Bradi2g38680.1Bradi2g38670.1
Bradi2g37080.1Bradi2g38700.1Bradi2g38685.1Bradi2g12216.1Bradi2g12204.1
Bradi1g20010.1Bradi1g20020.1Bradi1g19990.1Bradi1g20000.1Bradi2g38720.1
Bradi2g37090.1Bradi3g32110.1
Brassica rapaBra022567Bra001986Bra028285Bra021488Bra039137
Bra032476Bra030607Bra015402Bra023509Bra015403
Bra030606Bra037007Bra015404Bra023862Bra031309
Bra035235Bra011438Bra034561Bra032477Bra000113
Bra032475Bra032474
Carica papayaevm.model.supercontig_4.209evm.model.supercontig_26.281evm.model.supercontig_6.303evm.model.supercontig_3.163evm.model.supercontig_8.230
evm.model.supercontig_8.231evm.model.supercontig_198.1evm.model.supercontig_8.232evm.model.supercontig_9.151
Capsella rubellaCarubv10026787mCarubv10028504mCarubv10016167mCarubv10012652mCarubv10012469m
Carubv10003841mCarubv10001453mCarubv10005237mCarubv10009829mCarubv10014176m
Carubv10001445mCarubv10025622m
Citrus clementinaCiclev10021010mCiclev10006448mCiclev10017908mCiclev10001877mCiclev10027084m
Ciclev10007121mCiclev10005432mCiclev10026072mCiclev10015924m
Citrus sinensisorange1.1g020883morange1.1g041695morange1.1g019585morange1.1g021118morange1.1g021430m
orange1.1g020619morange1.1g020635morange1.1g017040morange1.1g019629morange1.1g048664m
Cucumis sativusCucsa.251120.1Cucsa.128460.1Cucsa.393950.1Cucsa.128450.1Cucsa.128470.1
Cucsa.043880.1Cucsa.072840.1Cucsa.170030.1Cucsa.148370.1Cucsa.363350.1
Cucsa.390630.1Cucsa.128490.1Cucsa.128480.1
Eucalyptus grandisEucgr.F03724.1Eucgr.A02844.1Eucgr.H03915.1Eucgr.H03910.1Eucgr.H00888.1
Eucgr.L00890.1Eucgr.J01616.1Eucgr.H00890.1Eucgr.A00966.1Eucgr.A01385.1
Eucgr.J01619.1Eucgr.J01618.1Eucgr.L02416.1Eucgr.J01614.1Eucgr.J01617.1
Eucgr.H00887.1Eucgr.H00889.1Eucgr.G01637.1Eucgr.J02484.1Eucgr.L02417.1
Eucgr.L02524.1Eucgr.J01615.1Eucgr.E03708.1Eucgr.E03715.1Eucgr.C02744.1
Eucgr.E03716.1Eucgr.E04120.1Eucgr.C02751.1Eucgr.C02747.1Eucgr.H03667.1
Eucgr.H01218.1Eucgr.H03666.1Eucgr.H00891.1Eucgr.K00806.1Eucgr.E04121.1
Eucgr.B01255.1Eucgr.K00809.1
Fragaria vescamrna22932.1-v1.0-hybridmrna06887.1-v1.0-hybridmrna19544.1-v1.0-hybridmrna03588.1-v1.0-hybridmrna12445.1-v1.0-hybrid
mrna14551.1-v1.0-hybridmrna23915.1-v1.0-hybridmrna23913.1-v1.0-hybridmrna13352.1-v1.0-hybridmrna06699.1-v1.0-hybrid
mrna11144.1-v1.0-hybridmrna31145.1-v1.0-hybrid
Glycine maxGlyma10g38520.1Glyma09g27390.1Glyma09g42130.1Glyma10g33520.1Glyma04g40530.1
Glyma09g42160.1Glyma20g00330.1Glyma14g40150.1Glyma10g01250.1Glyma10g01230.1
Glyma02g01190.1Glyma11g08520.1Glyma01g36780.1Glyma02g17060.1Glyma01g36780.2
Glyma12g32160.1Glyma13g38310.2Glyma03g36620.2Glyma20g35680.1Glyma09g28460.1
Glyma16g33250.1Glyma06g45920.1Glyma06g45910.1Glyma10g02730.1Glyma13g38300.1
Glyma12g32170.1Glyma12g10850.1Glyma06g45910.2Glyma03g36610.1Glyma16g32490.1
Glyma19g39270.2
Gossypium raimondiiGorai.003G006600.1Gorai.008G264300.1Gorai.008G007500.1Gorai.004G049000.1Gorai.004G049100.1
Gorai.004G049200.1Gorai.008G172200.1Gorai.009G192200.1Gorai.005G150500.1Gorai.010G001900.1
Gorai.008G172200.2Gorai.008G281600.1Gorai.012G046400.1Gorai.008G007700.1Gorai.011G184500.1
Gorai.011G184600.1Gorai.008G007600.1Gorai.013G099400.1Gorai.013G099600.1Gorai.005G150600.1
Gorai.005G150600.2Gorai.006G074900.1Gorai.013G099500.1
Linum usitatissimumLus10031664Lus10027405Lus10034547Lus10028736Lus10017288
Lus10005614Lus10032926Lus10028688Lus10038054Lus10027163
Lus10039681Lus10018374Lus10007638Lus10029543Lus10006756
Lus10015580Lus10039680Lus10041250Lus10027164Lus10021956
Lus10038055Lus10041249Lus10009990Lus10015127Lus10031548
Lus10020064
Malus domesticaMDP0000272643MDP0000451182MDP0000598572MDP0000678562MDP0000514027
MDP0000175043MDP0000509949MDP0000862126MDP0000218284MDP0000266658
MDP0000620579MDP0000849735MDP0000643021MDP0000449389MDP0000206768
MDP0000149327
Manihot esculentacassava4.1_030462mcassava4.1_024888mcassava4.1_026282mcassava4.1_022712mcassava4.1_030389m
cassava4.1_030603mcassava4.1_029175mcassava4.1_030116mcassava4.1_012142mcassava4.1_031318m
cassava4.1_026031mcassava4.1_026378mcassava4.1_011768mcassava4.1_011775mcassava4.1_023556m
cassava4.1_029372mcassava4.1_029294mcassava4.1_025818mcassava4.1_030342mcassava4.1_027519m
cassava4.1_031448mcassava4.1_023964mcassava4.1_026755mcassava4.1_028760m
Medicago truncatulaMedtr1g101830.1Medtr1g038680.1Medtr1g086320.1Medtr3g092990.1Medtr1g025980.1
Medtr3g092990.2Medtr8g075100.1Medtr5g022870.1Medtr1g086490.1Medtr7g035030.1
Medtr2g088770.1
Mimulus guttatusmgv1a010371mmgv1a010308mmgv1a010125mmgv1a009735mmgv1a009721m
mgv1a009971mmgv1a010695mmgv1a009942mmgv1a019406mmgv11b018535m
mgv1a009726mmgv1a017718mmgv1a010045mmgv1a009974mmgv1a021569m
mgv1a010031mmgv1a009213mmgv1a026649mmgv1a010025mmgv1a010112m
mgv1a010413mmgv1a022629mmgv1a009766mmgv1a009821mmgv1a009818m
mgv1a009802mmgv1a027126mmgv1a010460mmgv1a019767m
Oryza sativaLOC_Os05g06970.1LOC_Os01g22336.1LOC_Os01g22370.1LOC_Os07g34710.1LOC_Os02g58720.2
LOC_Os02g58720.1LOC_Os05g04500.1LOC_Os03g02939.1LOC_Os03g02920.1LOC_Os10g39170.1
LOC_Os11g43980.1LOC_Os05g04490.1LOC_Os07g01420.1LOC_Os03g25370.1LOC_Os07g01370.1
LOC_Os06g20150.1LOC_Os06g29470.1LOC_Os05g41990.1LOC_Os07g34670.1LOC_Os03g25360.1
LOC_Os06g46799.1LOC_Os05g04470.1LOC_Os07g44590.1LOC_Os05g04450.1LOC_Os07g06300.1
LOC_Os07g06190.1LOC_Os04g53640.1LOC_Os05g42000.1LOC_Os03g36560.1LOC_Os07g44550.1
LOC_Os03g25340.1LOC_Os01g22230.1LOC_Os03g25320.1LOC_Os07g44480.1LOC_Os07g44499.1
LOC_Os03g25300.1LOC_Os03g25280.1LOC_Os03g25330.1LOC_Os01g22249.1LOC_Os07g44460.1
LOC_Os01g18890.1LOC_Os07g01400.1LOC_Os01g28030.1LOC_Os02g06630.1LOC_Os02g58720.3
LOC_Os12g34524.1LOC_Os01g16450.1LOC_Os01g22230.2LOC_Os01g57730.1LOC_Os07g01410.1
LOC_Os07g34710.3LOC_Os07g34710.2LOC_Os05g04410.1LOC_Os04g04750.1LOC_Os01g18930.1
LOC_Os05g04380.1LOC_Os01g19020.1LOC_Os07g06175.1LOC_Os01g18970.1LOC_Os05g04440.1
LOC_Os07g06380.1LOC_Os01g18950.1LOC_Os05g04380.2LOC_Os01g22352.1LOC_Os10g39160.1
LOC_Os01g18910.1
Panicum virgatumPavirv00044436mPavirv00035344mPavirv00016231mPavirv00045234mPavirv00067047m
Pavirv00050773mPavirv00036782mPavirv00065543mPavirv00036784mPavirv00000823m
Pavirv00015735mPavirv00033829mPavirv00037097mPavirv00049652mPavirv00051773m
Pavirv00055968mPavirv00012325mPavirv00006439mPavirv00068608mPavirv00000691m
Pavirv00006153mPavirv00040480mPavirv00069183mPavirv00069497mPavirv00012470m
Pavirv00046769mPavirv00040468mPavirv00015808mPavirv00044710mPavirv00059241m
Pavirv00014977mPavirv00050593mPavirv00009813mPavirv00011553mPavirv00016723m
Pavirv00052170mPavirv00034630mPavirv00059415mPavirv00002373mPavirv00049434m
Pavirv00040863mPavirv00012420mPavirv00054164mPavirv00036783mPavirv00067809m
Pavirv00059393mPavirv00042375mPavirv00054722mPavirv00045339mPavirv00029237m
Pavirv00054723mPavirv00000698mPavirv00064219mPavirv00066428mPavirv00055085m
Pavirv00064221mPavirv00014089mPavirv00004916mPavirv00036786mPavirv00049155m
Pavirv00041015mPavirv00036156mPavirv00054042mPavirv00049735mPavirv00041743m
Pavirv00010288mPavirv00053333mPavirv00040553mPavirv00044012mPavirv00049438m
Pavirv00034846mPavirv00010289mPavirv00012102mPavirv00036142mPavirv00064220m
Pavirv00033031mPavirv00048030mPavirv00032795mPavirv00062564mPavirv00026218m
Pavirv00014323mPavirv00056122mPavirv00062109mPavirv00009815mPavirv00001774m
Pavirv00049838mPavirv00057639mPavirv00050644mPavirv00031771mPavirv00009814m
Pavirv00002032mPavirv00017683mPavirv00041363mPavirv00047668mPavirv00023480m
Pavirv00003693mPavirv00057171mPavirv00033836m
Physcomitrella patensPp1s385_42V6.1Pp1s201_38V6.1Pp1s160_154V6.1Pp1s411_26V6.1Pp1s89_182V6.1
Pp1s55_121V6.2Pp1s55_121V6.1Pp1s66_27V6.1Pp1s356_14V6.1Pp1s67_214V6.5
Pp1s67_214V6.4Pp1s67_214V6.3Pp1s67_214V6.2Pp1s67_214V6.1Pp1s1_302V6.1
Pp1s43_154V6.1Pp1s20_77V6.1
Phaseolus vulgarisPhvul.004G123100.1Phvul.007G065800.1Phvul.009G038500.1Phvul.003G003200.1Phvul.001G076000.1
Phvul.003G003100.1Phvul.001G003800.1Phvul.002G105400.1Phvul.007G211100.1Phvul.007G210900.1
Phvul.001G201300.1Phvul.007G114200.1Phvul.004G132000.1Phvul.011G105900.1Phvul.005G113800.1
Phvul.007G167200.1
Picea abiesMA_10431507g0020MA_750042g0010MA_102298g0010MA_412995g0010MA_5316g0010
MA_114903g0010MA_10435488g0010MA_93508g0010MA_63572g0010MA_9087g0010
MA_183305g0010MA_10433564g0020MA_87008g0010MA_46801g0010MA_9457778g0010
MA_651584g0010MA_18523g0010MA_163g0010MA_12626g0010MA_180698g0010
MA_41416g0010MA_115059g0010MA_188077g0010MA_10435488g0020MA_389258g0010
MA_9540939g0010MA_10428759g0010MA_774247g0010MA_10259419g0010MA_182004g0010
MA_10433564g0010MA_186946g0010MA_117730g0010MA_644225g0010MA_7239782g0010
Populus trichocarpaPotri.015G003600.1Potri.015G003500.1Potri.015G003500.2Potri.012G042800.1Potri.007G122300.1
Potri.007G122200.1Potri.005G108900.1Potri.002G018000.1Potri.007G122100.1Potri.017G038100.2
Potri.017G038100.1Potri.017G037900.1Potri.004G023200.1Potri.004G023100.1Potri.012G006800.2
Potri.012G006800.1Potri.004G134800.1Potri.T045500.1Potri.011G027300.1Potri.T099300.1
Potri.019G063200.1Potri.T089600.1Potri.017G037900.2Potri.018G136900.1Potri.015G138300.1
Prunus persicappa020970mppa008831mppa025326mppa015674mppa008896m
ppa008516mppa016743mppa008540mppa014996mppa014723m
ppa023088mppa024711mppa023401m
Ricinus communis27446.m00049229726.m00403728333.m00058227446.m00049430086.m000208
28962.m00043230170.m01427530147.m01413129726.m00396530156.m001761
29647.m002045.49.30529647.m002045.49.30529983.m00329529842.m00365429647.m002045.413.667
29647.m002045.413.66729726.m00396630156.m00176027446.m000493
Setaria italicaSi001958mSi010431mSi001913mSi010419mSi017767m
Si039828mSi036556mSi010422mSi025196mSi025162m
Si017751mSi036635mSi006880mSi032112mSi006881m
Si020699mSi014105mSi006873mSi022656mSi006871m
Si036566mSi030304mSi030495mSi024230mSi025059m
Si032029mSi001988mSi024554mSi033034mSi010487m
Si022555mSi020718mSi017675mSi002089mSi036439m
Si022615mSi039321mSi002248mSi040234mSi033206m
Si031937mSi036455mSi004255mSi003948mSi030179m
Si020698mSi020695mSi002064mSi017708mSi017693m
Si022557mSi002047mSi002052mSi029563mSi027715m
Si030855mSi030214mSi032796mSi022679mSi002666m
Selaginella moellendorffii177154126670429447266691229953
232359134234409361233332232728
407109
Sorghum bicolorSb03g013220.1Sb09g004660.1Sb03g013190.1Sb03g013200.1Sb04g038610.1
Sb08g016840.1Sb01g049140.1Sb09g004650.1Sb05g004180.1Sb09g002810.1
Sb01g030530.1Sb09g002830.1Sb04g031120.1Sb02g000470.1Sb10g011510.1
Sb10g011290.1Sb2674s002010.1Sb02g040770.1Sb07g001280.1Sb10g011530.1
Sb09g024580.1Sb10g027490.1Sb02g040740.1Sb09g024590.1Sb01g034420.1
Sb02g040750.1Sb09g002750.1Sb06g029370.1Sb04g004250.1Sb02g000490.1
Sb01g016600.1Sb03g011950.1Sb03g011960.1Sb09g002820.1Sb01g034430.2
Sb01g034430.1Sb09g002760.1Sb03g013210.1Sb02g040670.1Sb02g040680.1
Sb03g016510.1Sb03g010740.1Sb03g036760.1Sb01g004160.1Sb02g040690.1
Sb02g000520.1Sb04g020720.1Sb09g002740.1Sb03g011990.1Sb03g011980.1
Sb02g040730.1Sb02g040660.1Sb01g030540.1Sb02g040710.1Sb02g040720.1
Sb09g002770.1Sb02g000500.1Sb02g000510.1
Thellungiella halophilaThhalv10014117mThhalv10027848mThhalv10025702mThhalv10014085mThhalv10021152m
Thhalv10008157mThhalv10008202mThhalv10008189mThhalv10021123mThhalv10028797m
Thhalv10016858m
Vitis viniferaGSVIVT01018436001GSVIVT01008763001GSVIVT01005386001GSVIVT01031311001GSVIVT01028197001
GSVIVT01010664001GSVIVT01031312001.283.542GSVIVT01031312001.283.542GSVIVT01038659001.47.306GSVIVT01038659001.47.306
GSVIVT01000248001GSVIVT01030616001.52.310GSVIVT01030616001.52.310GSVIVT01030615001GSVIVT01011017001
GSVIVT01017830001GSVIVT01030616001.393.579GSVIVT01030616001.393.579GSVIVT01031312001.46.196GSVIVT01031312001.46.196
GSVIVT01038659001.403.563GSVIVT01038659001.403.563GSVIVT01004088001GSVIVT01007225001GSVIVT01012624001
Zea maysAC205413.4_FGT001AC205413.4_FGT003AC208341.4_FGT007AC205413.4_FGT002AC205154.3_FGT005
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)