| Basic Information | |
|---|---|
| Species | Thellungiella halophila |
| Cazyme ID | Thhalv10028329m |
| Family | AA2 |
| Protein Properties | Length: 190 Molecular Weight: 21147.1 Isoelectric Point: 10.3215 |
| Chromosome | Chromosome/Scaffold: 14 Start: 1854324 End: 1855151 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| External Links |
|---|
| CAZyDB |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 6 | 174 | 7.4e-25 |
| GPTWEVPKGRKDGRISKAIETRQLPAPTFNISQLQQSFGQRGLSMHDLVVLSGGHTLGFAHCSSFQNRIHNFNLQKQVDPTLNPSFAASLNVICPAHNKV KNAGATMDATTTYFDNVYYKMLMQGQSLFSFDQALLTTPSSKKLVAKYASSMEEYERAFVKSIIKMSSI | |||
| Full Sequence |
|---|
| Protein Sequence Length: 190 Download |
| NPDRYGPTWE VPKGRKDGRI SKAIETRQLP APTFNISQLQ QSFGQRGLSM HDLVVLSGGH 60 TLGFAHCSSF QNRIHNFNLQ KQVDPTLNPS FAASLNVICP AHNKVKNAGA TMDATTTYFD 120 NVYYKMLMQG QSLFSFDQAL LTTPSSKKLV AKYASSMEEY ERAFVKSIIK MSSISGNGKE 180 VRHNCRRVR* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00141 | peroxidase | 0.008 | 125 | 156 | 32 | + Peroxidase. | ||
| cd00691 | ascorbate_peroxidase | 7.0e-12 | 2 | 172 | 179 | + Ascorbate peroxidases and cytochrome C peroxidases. Ascorbate peroxidases are a subgroup of heme-dependent peroxidases of the plant superfamily that share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Along with related catalase-peroxidases, ascorbate peroxidases belong to class I of the plant superfamily. Ascorbate peroxidases are found in the chloroplasts and/or cytosol of algae and plants, where they have been shown to control the concentration of lethal hydrogen peroxide molecules. The yeast cytochrome c peroxidase is a divergent member of the family; it forms a complex with cytochrome c to catalyze the reduction of hydrogen peroxide to water. | ||
| pfam00141 | peroxidase | 7.0e-19 | 6 | 61 | 56 | + Peroxidase. | ||
| PLN03030 | PLN03030 | 3.0e-34 | 6 | 185 | 188 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 1.0e-82 | 6 | 188 | 187 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| EMBL | CBI18935.1 | 0 | 6 | 189 | 138 | 320 | unnamed protein product [Vitis vinifera] |
| RefSeq | NP_199033.1 | 0 | 6 | 189 | 134 | 317 | peroxidase 64 (PER64) (P64) (PRXR4) [Arabidopsis thaliana] |
| RefSeq | XP_002285892.1 | 0 | 6 | 189 | 134 | 316 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002300689.1 | 0 | 6 | 189 | 135 | 317 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002510587.1 | 0 | 6 | 188 | 134 | 317 | Peroxidase 64 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hdl_A | 5e-39 | 8 | 188 | 116 | 302 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1qgj_B | 1e-33 | 6 | 188 | 111 | 298 | A Chain A, Arabidopsis Thaliana Peroxidase N |
| PDB | 1qgj_A | 1e-33 | 6 | 188 | 111 | 298 | A Chain A, Arabidopsis Thaliana Peroxidase N |
| PDB | 1fhf_C | 2e-33 | 6 | 188 | 114 | 302 | A Chain A, The Structure Of Soybean Peroxidase |
| PDB | 1fhf_B | 2e-33 | 6 | 188 | 114 | 302 | A Chain A, The Structure Of Soybean Peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| EX083030 | 185 | 6 | 190 | 0 |
| EH419140 | 183 | 8 | 190 | 0 |
| EX085137 | 185 | 6 | 190 | 0 |
| DK572081 | 167 | 24 | 190 | 0 |
| DN490972 | 185 | 6 | 190 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
