| Basic Information | |
|---|---|
| Species | Volvox carteri |
| Cazyme ID | Vocar20000557m |
| Family | GT2 |
| Protein Properties | Length: 255 Molecular Weight: 27706 Isoelectric Point: 9.4165 |
| Chromosome | Chromosome/Scaffold: 19 Start: 1671552 End: 1672449 |
| Description | Nucleotide-diphospho-sugar transferases superfamily protein |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GT2 | 23 | 189 | 5.4e-39 |
| SVIVPTYNERPNVAVLAWLLHKYLDELVSFEVVFVDDNSPDGTANAIKQLQAVYGTSRIRLVCRPGKLGLGTAYAAGLAASSGRFIILMDADLSHHPKHL PDFIAAQRATDADVVAGTRYRLGGGVAGWNLTRKLTSRGANLLASFLLGARTSDLTGAYRLYRRGAL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 255 Download |
| MGSMDQPATS MGAKALTVDP EYSVIVPTYN ERPNVAVLAW LLHKYLDELV SFEVVFVDDN 60 SPDGTANAIK QLQAVYGTSR IRLVCRPGKL GLGTAYAAGL AASSGRFIIL MDADLSHHPK 120 HLPDFIAAQR ATDADVVAGT RYRLGGGVAG WNLTRKLTSR GANLLASFLL GARTSDLTGA 180 YRLYRRGALC ELLHATTSRG YAFQMEVIVR AQYSRLRITE MPIVFVDRLY GESKLGMGEY 240 VQFVRGLLGL LFGL* 300 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd04187 | DPM1_like_bac | 6.0e-25 | 24 | 186 | 164 | + Bacterial DPM1_like enzymes are related to eukaryotic DPM1. A family of bacterial enzymes related to eukaryotic DPM1; Although the mechanism of eukaryotic enzyme is well studied, the mechanism of the bacterial enzymes is not well understood. The eukaryotic DPM1 is the catalytic subunit of eukaryotic Dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. The enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
| cd04188 | DPG_synthase | 1.0e-25 | 24 | 234 | 214 | + DPG_synthase is involved in protein N-linked glycosylation. UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. | ||
| cd04179 | DPM_DPG-synthase_like | 3.0e-52 | 24 | 211 | 188 | + DPM_DPG-synthase_like is a member of the Glycosyltransferase 2 superfamily. DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. The UDP-glucose:dolichyl-phosphate glucosyltransferase (DPG_synthase) is a transmembrane-bound enzyme of the endoplasmic reticulum involved in protein N-linked glycosylation. This enzyme catalyzes the transfer of glucose from UDP-glucose to dolichyl phosphate. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
| cd06442 | DPM1_like | 9.0e-90 | 24 | 245 | 222 | + DPM1_like represents putative enzymes similar to eukaryotic DPM1. Proteins similar to eukaryotic DPM1, including enzymes from bacteria and archaea; DPM1 is the catalytic subunit of eukaryotic dolichol-phosphate mannose (DPM) synthase. DPM synthase is required for synthesis of the glycosylphosphatidylinositol (GPI) anchor, N-glycan precursor, protein O-mannose, and C-mannose. In higher eukaryotes,the enzyme has three subunits, DPM1, DPM2 and DPM3. DPM is synthesized from dolichol phosphate and GDP-Man on the cytosolic surface of the ER membrane by DPM synthase and then is flipped onto the luminal side and used as a donor substrate. In lower eukaryotes, such as Saccharomyces cerevisiae and Trypanosoma brucei, DPM synthase consists of a single component (Dpm1p and TbDpm1, respectively) that possesses one predicted transmembrane region near the C terminus for anchoring to the ER membrane. In contrast, the Dpm1 homologues of higher eukaryotes, namely fission yeast, fungi, and animals, have no transmembrane region, suggesting the existence of adapter molecules for membrane anchoring. This family also includes bacteria and archaea DPM1_like enzymes. However, the enzyme structure and mechanism of function are not well understood. This protein family belongs to Glycosyltransferase 2 superfamily. | ||
| PLN02726 | PLN02726 | 2.0e-134 | 12 | 245 | 234 | + dolichyl-phosphate beta-D-mannosyltransferase | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ABK22980.1 | 0 | 20 | 252 | 12 | 243 | unknown [Picea sitchensis] |
| GenBank | ACN40933.1 | 0 | 20 | 252 | 12 | 243 | unknown [Picea sitchensis] |
| RefSeq | NP_001051751.1 | 0 | 21 | 252 | 11 | 241 | Os03g0824400 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | XP_001695552.1 | 0 | 20 | 254 | 19 | 254 | glycosyl transferase [Chlamydomonas reinhardtii] |
| RefSeq | XP_002285933.1 | 0 | 21 | 251 | 11 | 240 | PREDICTED: hypothetical protein [Vitis vinifera] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3bcv_B | 0.000003 | 20 | 114 | 5 | 94 | A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis |
| PDB | 3bcv_A | 0.000003 | 20 | 114 | 5 | 94 | A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis |
| PDB | 3e26_A | 0.001 | 23 | 123 | 46 | 146 | A Chain A, Crystal Structure Of A Putative Glycosyltransferase From Bacteroides Fragilis |
| PDB | 3e25_A | 0.001 | 23 | 123 | 46 | 146 | A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase |
| PDB | 4dec_A | 0.001 | 23 | 123 | 66 | 166 | A Chain A, Crystal Structure Of M. Tuberculosis Glucosyl-3- Phosphoglycerate Synthase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| FD809211 | 217 | 1 | 217 | 0 |
| EX356800 | 226 | 20 | 245 | 0 |
| EX367698 | 226 | 20 | 245 | 0 |
| EX440001 | 226 | 20 | 245 | 0 |
| EX380752 | 226 | 20 | 245 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |