y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20004494m
FamilyGT34
Protein PropertiesLength: 204 Molecular Weight: 23978.3 Isoelectric Point: 7.1245
ChromosomeChromosome/Scaffold: 8 Start: 2644645 End: 2645256
DescriptionGalactosyl transferase GMA12/MNN10 family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT3451873.6e-31
  MESFLNKFKYAHYYNYEFIPIFWNFKDPDLPGAWAKIPALQRYLPYYDWVWSMDVDAFVTNRRLSIEEHVLKHIPLDKAVVIARDCNHLNTGSFLIRNTP
  RAFQFLDAVYSLRRNTSLHLYDIWYEQSAVIHVFDHDIEGLTSTFHLIPQQKLNSYSSNCGHTWQLRDFVVHFPGQAEKSKAW
Full Sequence
Protein Sequence     Length: 204     Download
FDHVMESFLN KFKYAHYYNY EFIPIFWNFK DPDLPGAWAK IPALQRYLPY YDWVWSMDVD    60
AFVTNRRLSI EEHVLKHIPL DKAVVIARDC NHLNTGSFLI RNTPRAFQFL DAVYSLRRNT    120
SLHLYDIWYE QSAVIHVFDH DIEGLTSTFH LIPQQKLNSY SSNCGHTWQL RDFVVHFPGQ    180
AEKSKAWANL LRKGGAELQE LLP*                                           240
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03314DUF2730.00054313899+
PLN03181PLN031813.0e-72112122+
PLN03182PLN031821.0e-122112130+
pfam05637Glyco_transf_342.0e-276179208+
Gene Ontology
GO TermDescription
GO:0016021integral to membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_592826.10.00000000000056179122327alpha-1,2-galactosyltransferase Gmh2 (predicted) [Schizosaccharomyces pombe]
RefSeqNP_594832.10.000000000000310179114313alpha-1,2-galactosyltransferase Gmh3 [Schizosaccharomyces pombe 972h-]
RefSeqXP_001588835.10.00000000000091017988283hypothetical protein SS1G_10383 [Sclerotinia sclerotiorum 1980]
RefSeqXP_002173199.10.00000000000085179124325alpha-1,2-galactosyltransferase gmh3 [Schizosaccharomyces japonicus yFS275]
RefSeqXP_002175510.10.0000000000011179106310alpha-1,2-galactosyltransferase gmh3 [Schizosaccharomyces japonicus yFS275]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD817686118872040
FD800911651402049e-37
FD884042601452042e-32
GW23217618961852e-23
GW23082716261631e-16
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00205.1Aquca_002_00702.1Aquca_060_00047.1
Arabidopsis lyrata490316312817907847487607476571
912562481152
Arabidopsis thalianaAT4G02500.1AT1G18690.1AT3G62720.2AT3G62720.1AT1G74380.1
AT5G07720.1AT2G22900.1AT4G37690.1AT4G38310.1
Brachypodium distachyonBradi3g44800.1Bradi4g42610.1Bradi1g64950.1Bradi1g64570.1Bradi1g64560.1
Bradi4g16670.1Bradi3g56507.1
Brassica rapaBra018545Bra036262Bra000877Bra014396Bra009305
Bra015915Bra007696Bra003804Bra025677Bra039938
Bra017847Bra008146
Carica papayaevm.model.supercontig_9.211evm.model.supercontig_13.296evm.model.supercontig_103.100
Capsella rubellaCarubv10000917mCarubv10000915mCarubv10017185mCarubv10009116mCarubv10000835m
Carubv10020269mCarubv10023195m
Chlamydomonas reinhardtiiCre01.g031650.t1.3Cre11.g474750.t1.3
Citrus clementinaCiclev10004948mCiclev10020086mCiclev10020012mCiclev10025585m
Citrus sinensisorange1.1g047753morange1.1g012705morange1.1g012077morange1.1g045999m
Cucumis sativusCucsa.253090.1Cucsa.205700.1Cucsa.103300.1Cucsa.197880.1Cucsa.197890.1
Cucsa.318300.1
Eucalyptus grandisEucgr.B01313.1Eucgr.B00540.1Eucgr.I00693.1
Fragaria vescamrna06894.1-v1.0-hybridmrna10573.1-v1.0-hybridmrna26058.1-v1.0-hybridmrna05784.1-v1.0-hybridmrna10438.1-v1.0-hybrid
Glycine maxGlyma19g39760.1Glyma09g05010.2Glyma09g05010.1Glyma05g00860.1Glyma17g11060.1
Glyma03g37150.1Glyma11g05020.1Glyma01g40270.1Glyma05g22680.1Glyma15g15820.1
Gossypium raimondiiGorai.005G060400.1Gorai.N024600.1Gorai.004G052700.1Gorai.007G128800.1Gorai.003G098400.1
Gorai.008G195000.1Gorai.008G084100.5Gorai.008G084100.4Gorai.008G084100.3Gorai.008G084100.2
Gorai.003G031400.1Gorai.007G224800.1Gorai.008G084100.1.129.222Gorai.008G084100.1.129.222Gorai.008G084100.1.223.370
Gorai.008G084100.1.223.370
Linum usitatissimumLus10037519Lus10002870Lus10037516Lus10021631Lus10000563
Lus10019076Lus10015721Lus10037514Lus10011550Lus10019265
Lus10037520
Malus domesticaMDP0000306139MDP0000628100MDP0000512420MDP0000213291MDP0000374557
MDP0000267641MDP0000197595MDP0000173397MDP0000186772MDP0000871602
MDP0000243498.466.743MDP0000243498.466.743MDP0000186170MDP0000860874MDP0000146168
MDP0000124832MDP0000243498.109.299MDP0000243498.109.299MDP0000186172MDP0000129630
MDP0000162905
Manihot esculentacassava4.1_034186mcassava4.1_007254mcassava4.1_007448mcassava4.1_026770mcassava4.1_027503m
cassava4.1_028965m
Medicago truncatulaMedtr8g058450.1Medtr4g119880.1Medtr5g015260.1Medtr4g097230.1Medtr4g097240.1
Mimulus guttatusmgv1a027105mmgv1a027073mmgv1a003740mmgv1a006132mmgv1a006038m
mgv1a006348mmgv1a018855m.124.226mgv1a018855m.124.226mgv1a018855m.226.387mgv1a018855m.226.387
Oryza sativaLOC_Os02g32750.2LOC_Os02g32750.1LOC_Os12g05380.1LOC_Os03g18820.2LOC_Os03g18820.1
LOC_Os03g19310.1LOC_Os03g19330.1LOC_Os11g34390.1LOC_Os02g49140.1
Panicum virgatumPavirv00048309mPavirv00046900mPavirv00067397mPavirv00021533mPavirv00058176m
Pavirv00041348mPavirv00058240mPavirv00025200mPavirv00028711mPavirv00058241m
Pavirv00058175mPavirv00005933mPavirv00063789mPavirv00028712mPavirv00048487m
Pavirv00023312mPavirv00024996mPavirv00027797m.46.148Pavirv00027797m.46.148Pavirv00040967m
Pavirv00027797m.155.303Pavirv00027797m.155.303
Physcomitrella patensPp1s210_35V6.2Pp1s210_35V6.1Pp1s17_404V6.1Pp1s216_58V6.1Pp1s151_51V6.1
Pp1s20_331V6.3Pp1s20_331V6.2Pp1s20_331V6.1Pp1s74_206V6.2Pp1s74_206V6.1
Pp1s185_87V6.1Pp1s71_269V6.1Pp1s52_88V6.1Pp1s298_59V6.3Pp1s298_59V6.2
Pp1s298_59V6.1Pp1s91_136V6.1Pp1s118_95V6.1Pp1s143_13V6.1Pp1s20_391V6.1
Pp1s167_73V6.2Pp1s167_73V6.1Pp1s17_17V6.1Pp1s100_136V6.1Pp1s35_169V6.1
Pp1s96_121V6.1Pp1s20_331V6.4Pp1s85_95V6.1.231.346Pp1s85_95V6.1.231.346Pp1s85_95V6.1.139.224
Pp1s85_95V6.1.139.224Pp1s42_153V6.1Pp1s31_396V6.1
Phaseolus vulgarisPhvul.001G206000.2Phvul.001G206000.1Phvul.009G248100.1Phvul.003G188200.1Phvul.002G009900.1
Picea abiesMA_5873g0010MA_10428947g0010MA_48841g0010MA_101873g0010MA_53390g0010
MA_123211g0010MA_124049g0020
Populus trichocarpaPotri.010G025300.1Potri.008G208000.1Potri.010G025100.1Potri.015G061800.3Potri.015G061800.1
Potri.012G068300.1Potri.007G005900.2Potri.007G005900.1Potri.014G008800.2Potri.014G008800.1
Potri.014G006100.1Potri.015G061800.2
Prunus persicappa005690mppa005479mppa005681mppa017391mppa019851m
ppa006622m
Ricinus communis29726.m00404130138.m00403930169.m00636729661.m000937
Setaria italicaSi017087mSi035653mSi012801mSi028282mSi038774m
Si027422mSi009922mSi038629mSi039147mSi027576m
Si028029mSi027617mSi026397m.111.200Si026397m.111.200Si026397m.210.375
Si026397m.210.375Si026788mSi030580m
Selaginella moellendorffii11214313118341469088477112156
9707764648411111
Sorghum bicolorSb04g021570.1Sb08g003090.1Sb03g005110.1Sb01g038000.1Sb01g037530.1
Sb08g003080.1Sb01g037540.1Sb05g020910.1Sb05g020930.1Sb04g029500.1
Sb05g020911.1Sb02g009950.1
Thellungiella halophilaThhalv10028641mThhalv10007657mThhalv10018522mThhalv10005949mThhalv10013509m
Thhalv10000162mThhalv10027092m
Vitis viniferaGSVIVT01017760001GSVIVT01007963001GSVIVT01027978001
Volvox carteriVocar20014473m
Zea maysAC186147.3_FGT008
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)