CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20005683m
FamilyGH125
Protein PropertiesLength: 565 Molecular Weight: 62970.1 Isoelectric Point: 6.4132
ChromosomeChromosome/Scaffold: 11 Start: 2717261 End: 2724455
Description
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH1251095080
  ELQALCGRCLHQTITKSVEVRGIGESVFVATGDIPDEWLRDGSVQLSVYLPRLAEHPVLRPIIEGAIRTQAYYILSDPWANSYRKDWVRPDSLGKFERQI
  GRGGWIATRNFEVDSGAYWLNLLWNYASTEGSLWAAASFLNSSLVHDAAALLVDTWRLEQRHEEASPYRYAELPREGKGALSNYTGMIWSGFRPSDDPNT
  YGFNIPVNMYAAGSLERLVELNKLVWRDPMLGIAAAKLAEDIRQGIEKFGVVPLPAEKSGSSSSPSTIYAYEVDGLGKALASFDDPNIPSLLSVPLLGYR
  HYDPEVYGRTRQRILSPANSHYYAGKELRGCGSPHTPHRYVWSLAHCVQGLTSEEPGERADLFRQLLKMQGGNGLMHESNDVDHPGQLTRPLFQWANTML
Full Sequence
Protein Sequence     Length: 565     Download
MLPRNGATVR RWQHHPLALY LSLAVNAYVL IYVMFHQRTV EKTSTAPADH LLITDYKRAQ    60
LAASQPLFGN AWPSLTGGLP EVWALGTLGA NESFASDVEA NLSPAEREEL QALCGRCLHQ    120
TITKSVEVRG IGESVFVATG DIPDEWLRDG SVQLSVYLPR LAEHPVLRPI IEGAIRTQAY    180
YILSDPWANS YRKDWVRPDS LGKFERQIGR GGWIATRNFE VDSGAYWLNL LWNYASTEGS    240
LWAAASFLNS SLVHDAAALL VDTWRLEQRH EEASPYRYAE LPREGKGALS NYTGMIWSGF    300
RPSDDPNTYG FNIPVNMYAA GSLERLVELN KLVWRDPMLG IAAAKLAEDI RQGIEKFGVV    360
PLPAEKSGSS SSPSTIYAYE VDGLGKALAS FDDPNIPSLL SVPLLGYRHY DPEVYGRTRQ    420
RILSPANSHY YAGKELRGCG SPHTPHRYVW SLAHCVQGLT SEEPGERADL FRQLLKMQGG    480
NGLMHESNDV DHPGQLTRPL FQWANTMLVV YYEQTFGRSC SPYAEALRLQ GVAQREAREN    540
LLPRNGGPDL PAYYDRLEQS IPHV*                                          600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG3538COG35386.0e-10592507427+
pfam06824DUF12372.0e-118132507388+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001695184.101465081357predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_002183418.109856486543predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
RefSeqYP_003241779.1011850935416hypothetical protein GYMC10_1689 [Geobacillus sp. Y412MC10]
RefSeqZP_04852201.1010751121410conserved hypothetical protein [Paenibacillus sp. oral taxon 786 str. D14]
RefSeqZP_05129785.1010951831429conserved hypothetical protein [Clostridium sp. 7_2_43FAA]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2nvp_A010651924427A Chain A, X-Ray Crystal Structure Of Protein Cpf_0428 From Clostridium Perfringens. Northeast Structural Genomics Consortium Target Cpr63
PDB3qt9_A010651924427A Chain A, X-Ray Crystal Structure Of Protein Cpf_0428 From Clostridium Perfringens. Northeast Structural Genomics Consortium Target Cpr63
PDB3qt3_A010651924427A Chain A, Analysis Of A New Family Of Widely Distributed Metal-Independent Alpha-Mannosidases Provides Unique Insight Into The Processing Of N- Linked Glycans, Clostridium Perfringens Cpe0426 Apo-Structure
PDB3qsp_B011650931416A Chain A, Analysis Of A New Family Of Widely Distributed Metal-Independent Alpha-Mannosidases Provides Unique Insight Into The Processing Of N- Linked Glycans, Clostridium Perfringens Cpe0426 Apo-Structure
PDB3qsp_A011650931416A Chain A, Analysis Of A New Family Of Widely Distributed Metal-Independent Alpha-Mannosidases Provides Unique Insight Into The Processing Of N- Linked Glycans, Clostridium Perfringens Cpe0426 Apo-Structure
Transmembrane Domains
StartEnd
1736
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD87659217711770
CX3015932452675080
FC5106002422534664.00001e-40
CT901924290973632e-37
GE2536571454185611e-36
Orthologous Group
SpeciesID
Chlamydomonas reinhardtiig9090.t1
Physcomitrella patensPp1s2536_2V6.1
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny