y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20006426m
FamilyGT35
Protein PropertiesLength: 1010 Molecular Weight: 113499 Isoelectric Point: 7.0434
ChromosomeChromosome/Scaffold: 7 Start: 2549078 End: 2559391
Descriptionalpha-glucan phosphorylase 2
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT352789930
  ALAELGYDLETLSELERDAALGNGGLGRLAACFLDSMATLNLPAWGYGIRYQYGMFRQTIQNGFQHEQPDYWLTFGNPWEIERLIVQYPIKFYGHVSVVN
  EEGRQLFRWNAGETVTAVAYDNPIPGFGTRNCINLRLWAAKPSKEFDLEAFNTGDYVAAILSKQRAETLSSVLYPDDRTYEGKELRLKQQHFFVSATIQD
  CVRRYRDAHPDNNWETFPTKVAFQLNDTHPTIAVAELMRVLMDDHRLGWTKSWEICTKVFAFTNHTVLPEALERWPVPLLEKLLPRHMQIIYDINWRFLQ
  QVRNKYGDDWERISRMSIIEEGANGEKFVRMAYLAVVASHSVNGVAAIHSEIIKDTIFKDFYDLWPGKFQNKTNGVTQRRWLAFCNPPLRNLITKRLGSD
  DWILHLDNLKGLRAHADDPEFQAEWREVKQAAKVKAAALIQRLTGVKINTNAMFDIQVKRIHEYKRQLLNVMGIIYRYDQIKKMSREQRKAVVPRVCVIG
  GKAAPGYEMAKRIIKLVCAVGDKINSDPDVGDLLKLIFVPDYNVSSAEVLIPASELSQHISTAGTEASGTSNMKFTMNGSLIIGTLDGANVEIAEEIGDD
  NIFIFGAKAHEVPRLRAERRNLRPDDRFNHVISMIRSGYFGWEDYFSPVMDAITTGGDYYLVANDFPAYIDMQAKVDATYRDPAKWTRMSIMGTAGSGKF
  STDRTIAEYAHDIWHA
Full Sequence
Protein Sequence     Length: 1010     Download
MASALRQGLS APVAAPRTSS GNVPVPVAPA PVLRGKSLVP ARRMVSGPAR SIPAPPQVAA    60
PESPAAQGVV EVFVDNNSDT NFTVINVQAA NKPGLLTAIT ALFRDIGVDV GKAVVDGDEN    120
KINDTFYVRT LTGGKLSDDK AADAVRSLEV LLRSKPSSTG VSRPKFEAQG QGQSGKARLY    180
TLMDTYMKND VLSIQEDIVN HVEYTLARSR VNFDNFEAYQ ATSLSLRDRL IERWNDTQTW    240
FKEKDPKRVY YLSMEFLMGR SLLNTLYNLD IKEAYNEALA ELGYDLETLS ELERDAALGN    300
GGLGRLAACF LDSMATLNLP AWGYGIRYQY GMFRQTIQNG FQHEQPDYWL TFGNPWEIER    360
LIVQYPIKFY GHVSVVNEEG RQLFRWNAGE TVTAVAYDNP IPGFGTRNCI NLRLWAAKPS    420
KEFDLEAFNT GDYVAAILSK QRAETLSSVL YPDDRTYEGK ELRLKQQHFF VSATIQDCVR    480
RYRDAHPDNN WETFPTKVAF QLNDTHPTIA VAELMRVLMD DHRLGWTKSW EICTKVFAFT    540
NHTVLPEALE RWPVPLLEKL LPRHMQIIYD INWRFLQQVR NKYGDDWERI SRMSIIEEGA    600
NGEKFVRMAY LAVVASHSVN GVAAIHSEII KDTIFKDFYD LWPGKFQNKT NGVTQRRWLA    660
FCNPPLRNLI TKRLGSDDWI LHLDNLKGLR AHADDPEFQA EWREVKQAAK VKAAALIQRL    720
TGVKINTNAM FDIQVKRIHE YKRQLLNVMG IIYRYDQIKK MSREQRKAVV PRVCVIGGKA    780
APGYEMAKRI IKLVCAVGDK INSDPDVGDL LKLIFVPDYN VSSAEVLIPA SELSQHISTA    840
GTEASGTSNM KFTMNGSLII GTLDGANVEI AEEIGDDNIF IFGAKAHEVP RLRAERRNLR    900
PDDRFNHVIS MIRSGYFGWE DYFSPVMDAI TTGGDYYLVA NDFPAYIDMQ AKVDATYRDP    960
AKWTRMSIMG TAGSGKFSTD RTIAEYAHDI WHAEPCAVPQ PEASGNGSS*               1020
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd04300GT1_Glycogen_Phosphorylase0195993805+
TIGR02093P_ylase0198992801+
pfam00343Phosphorylase0278995724+
PRK14986PRK149860180995822+
COG0058GlgP0190995817+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
GO:0008152metabolic process
GO:0016597amino acid binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABB88567.10231003251001PhoB [Chlamydomonas reinhardtii]
EMBLCAL51609.1074100155988starch phosphorylase 3 (IC) [Ostreococcus tauri]
GenBankEEH55145.10101004171015glycosyltransferase family 35 protein [Micromonas pusilla CCMP1545]
RefSeqXP_001694015.10231003251001starch phosphorylase [Chlamydomonas reinhardtii]
RefSeqXP_002505241.1012410018887glycosyltransferase family 35 protein [Micromonas sp. RCC299]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1ygp_B018999739879A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB1ygp_A018999739879A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB3t3i_A0190100223838A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB3t3h_A0190100223838A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
PDB3t3g_A0190100223838A Chain A, Phosphorylated Form Of Yeast Glycogen Phosphorylase With Phosphate Bound In The Active Site.
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO58625255345410030
HO7799245931267030
HO3769774485539990
HO4174592936099010
HO4174591984065990
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_007176mcassava4.1_004717m.211.560
cassava4.1_004717m.211.560cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195
cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)