y PlantCAZyme

CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20011931m
FamilyGT23
Protein PropertiesLength: 448 Molecular Weight: 50253.5 Isoelectric Point: 7.3586
ChromosomeChromosome/Scaffold: 46 Start: 510850 End: 514615
Description
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT231144305.1e-22
  QHPPDCSKAKYLVYAVHPNGIGAVFHVTGVALHLALDLGRVFVEQSGTFLTGHPKCNGKDTLDSCYFLPFSGCRPTEEQMKSAVTISFEDENLLVQPGAD
  PTTLHANAAVVIATHGALVKIRAAAPRRFQARLSATAMDPKKHYYWWRAQSVAYMLRPRPEVLADLEERRSRLLAGPTPLPGCISVHVRHGDKGVEAEVF
  EDKMYDEIAAKLRALAPSYFTDQLFVSTEDPETINYFVNQTNGKWHTGYTAGVPRKPDRHRPNLAYMAEIGYYEEMLNSLLNLDLALECSGFVGSIFSNW
  VRLIDELRATMRCKANA
Full Sequence
Protein Sequence     Length: 448     Download
MPYRVLQAVG LAALTTCLVA IYFRQQKLSA IHIHLNTHEM EHRDVIPGDK QKTTVKALPA    60
LAEPWGSHHM FLRQAPYDPC PKQFIEGTWT SKRSMGNATL PLTLEAQREI HEHQHPPDCS    120
KAKYLVYAVH PNGIGAVFHV TGVALHLALD LGRVFVEQSG TFLTGHPKCN GKDTLDSCYF    180
LPFSGCRPTE EQMKSAVTIS FEDENLLVQP GADPTTLHAN AAVVIATHGA LVKIRAAAPR    240
RFQARLSATA MDPKKHYYWW RAQSVAYMLR PRPEVLADLE ERRSRLLAGP TPLPGCISVH    300
VRHGDKGVEA EVFEDKMYDE IAAKLRALAP SYFTDQLFVS TEDPETINYF VNQTNGKWHT    360
GYTAGVPRKP DRHRPNLAYM AEIGYYEEML NSLLNLDLAL ECSGFVGSIF SNWVRLIDEL    420
RATMRCKANA VFADVHYQNP HEMDVNW*                                       480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like0.0005238424195+
cd11296O-FucT_like2.0e-7269421163+
cd11300Fut8_like2.0e-14102318224+
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001048463.10.00000000000000262423183567Os02g0809500 [Oryza sativa (japonica cultivar-group)]
RefSeqXP_001690824.105744636451mitochondrial inner membrane translocase [Chlamydomonas reinhardtii]
RefSeqXP_001695253.12e-4010643924379predicted protein [Chlamydomonas reinhardtii]
RefSeqXP_001698490.1014044716342hypothetical protein CHLREDRAFT_142942 [Chlamydomonas reinhardtii]
RefSeqXP_002521988.16e-16101423215568conserved hypothetical protein [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2de0_X0.0000000987441115443X Chain X, Crystal Structure Of Human Alpha 1,6-fucosyltransferase, Fut8
Transmembrane Domains
StartEnd
523
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FD8354821702794480
FC0837841483074480
GW2217582232374483.00018e-42
BJ5878072052344352e-31
BJ5799272052344352e-31
Orthologous Group
SpeciesID
Chlamydomonas reinhardtiiCre10.g449050.t1.2
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny