CAZyme Information

Basic Information
SpeciesVolvox carteri
Cazyme IDVocar20014778m
FamilyAA6
Protein PropertiesLength: 262 Molecular Weight: 27317.9 Isoelectric Point: 5.6072
ChromosomeChromosome/Scaffold: 28 Start: 1535405 End: 1537921
DescriptionQuinone reductase family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA6632580
  KVFIIFYSTYGHIYQLAQSYKAALETVEDVEVSLFQVAETLPADVLEKMHAPTKPDVPLADPHKLPEADAFVFGFPTRFGMMCSQMKNFFDATGMLWQNG
  ALHGKPVSLFTSTASQGGGQETTLMTAVTQLAHHGMIYVSAGYAAGGVMFGLQEAKGGSPWGAGTLAGPDGSRQPSEGELEAIRSQAKAFGPIAKK
Full Sequence
Protein Sequence     Length: 262     Download
MGNVCGGQAN AVDAPTTANP TSANAATTEP AVAKTDAKPE ASVGEAKDAE LPKEPSQPQK    60
KLKVFIIFYS TYGHIYQLAQ SYKAALETVE DVEVSLFQVA ETLPADVLEK MHAPTKPDVP    120
LADPHKLPEA DAFVFGFPTR FGMMCSQMKN FFDATGMLWQ NGALHGKPVS LFTSTASQGG    180
GQETTLMTAV TQLAHHGMIY VSAGYAAGGV MFGLQEAKGG SPWGAGTLAG PDGSRQPSEG    240
ELEAIRSQAK AFGPIAKKLA A* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam00258Flavodoxin_14.0e-766197144+
pfam03358FMN_red4.0e-1762209152+
COG0655WrbA1.0e-4260259209+
TIGR01755flav_wrbA2.0e-6563259197+
PRK03767PRK037671.0e-8063261199+
Gene Ontology
GO TermDescription
GO:0009055electron carrier activity
GO:0016491oxidoreductase activity
GO:0050662coenzyme binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_001698549.105126159272flavodoxin [Chlamydomonas reinhardtii]
RefSeqXP_001698550.106026177279flagellar associated protein, quinone reductase-like protein [Chlamydomonas reinhardtii]
RefSeqXP_001698551.10622612201flagellar flavodoxin [Chlamydomonas reinhardtii]
RefSeqXP_001698552.10622612201flagellar flavodoxin [Chlamydomonas reinhardtii]
RefSeqXP_001762556.10632594199predicted protein [Physcomitrella patens subsp. patens]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4dy4_C0632592195A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB4dy4_A0632592195A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6m_B0632593196A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6m_A0632593196A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
PDB3b6k_B0632593196A Chain A, High Resolution Structure Of E.coli Wrba With Fmn
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
FC093831204602620
FD865140201622620
FD805762201622620
FD860311201622620
FD868828201622620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_010_00427.1Aquca_028_00272.1Aquca_028_00272.2Aquca_045_00040.1Aquca_028_00272.4
Aquca_028_00272.3Aquca_045_00041.1
Arabidopsis lyrata912689492071495531497377496008
Arabidopsis thalianaAT4G36750.1AT4G27270.1AT5G54500.1AT5G58800.2AT5G58800.1
AT5G54500.2
Brachypodium distachyonBradi3g27210.2Bradi2g51980.1Bradi2g20710.2Bradi1g59450.1Bradi1g59440.1
Bradi1g08640.1Bradi2g20710.1
Brassica rapaBra017781Bra029025Bra022724Bra002982Bra020352
Bra026364Bra020939Bra024671Bra033447Bra026424
Bra015354Bra026588Bra028316Bra013991
Carica papayaevm.model.supercontig_62.114evm.model.supercontig_12.2evm.model.supercontig_27.163evm.model.supercontig_112.39
Capsella rubellaCarubv10007228mCarubv10027151mCarubv10027183mCarubv10005724mCarubv10027138m
Chlamydomonas reinhardtiiCre10.g456000.t1.2Cre10.g456050.t2.1Cre10.g456050.t1.2Cre10.g456100.t1.2g11188.t1
Citrus clementinaCiclev10026310mCiclev10029120mCiclev10009497mCiclev10009518mCiclev10016752m
Ciclev10029300mCiclev10009723mCiclev10017062mCiclev10029304m
Citrus sinensisorange1.1g024934morange1.1g040588morange1.1g029532morange1.1g028841morange1.1g029479m
orange1.1g028847morange1.1g028917morange1.1g031039morange1.1g031827morange1.1g031823m
orange1.1g031807morange1.1g031886m
Cucumis sativusCucsa.104940.1Cucsa.109910.1Cucsa.059590.1Cucsa.045690.1Cucsa.045690.2
Cucsa.139160.1
Eucalyptus grandisEucgr.I01248.1Eucgr.D00882.1Eucgr.F03383.1Eucgr.B02266.3Eucgr.B02266.2
Eucgr.B02266.1Eucgr.B02266.4Eucgr.I01248.2Eucgr.I02466.1
Fragaria vescamrna29536.1-v1.0-hybridmrna02174.1-v1.0-hybridmrna03258.1-v1.0-hybridmrna30664.1-v1.0-hybridmrna07872.1-v1.0-hybrid
Glycine maxGlyma11g06920.1Glyma01g38400.1Glyma11g12790.1Glyma12g04940.1Glyma12g17680.1
Glyma12g34500.2Glyma12g34500.1Glyma12g17680.2Glyma13g35994.1Glyma12g25950.1
Glyma07g30750.1Glyma08g06570.1Glyma15g07040.2Glyma15g07040.1Glyma13g32300.1
Glyma13g32300.2Glyma14g37150.3Glyma14g37150.2Glyma14g37150.1Glyma13g32310.1
Glyma06g40750.2Glyma06g40700.1Glyma12g25950.2Glyma06g40730.1Glyma08g06570.2
Glyma06g39970.1Glyma19g02750.2Glyma04g13531.1Glyma06g40810.2Glyma12g23000.2
Glyma14g22010.1Glyma11g33050.2
Gossypium raimondiiGorai.003G016700.1Gorai.005G228800.3Gorai.005G228800.2Gorai.005G228800.1Gorai.007G206100.3
Gorai.007G206100.1Gorai.008G069000.1Gorai.009G429200.1Gorai.002G079100.1Gorai.011G020200.1
Gorai.003G123300.6Gorai.003G123300.5Gorai.003G123300.4Gorai.003G123300.2Gorai.003G123300.1
Gorai.003G123300.7Gorai.003G123300.8Gorai.009G429200.2Gorai.002G079100.2Gorai.003G123300.9
Gorai.007G206100.2Gorai.003G123300.3
Linum usitatissimumLus10014325Lus10026035Lus10041718Lus10040486Lus10018401
Lus10007612Lus10006748Lus10020076Lus10005862Lus10024032
Malus domesticaMDP0000404722MDP0000301453MDP0000896493MDP0000393227MDP0000509613
MDP0000829416MDP0000295439MDP0000181421.64.175MDP0000181421.64.175MDP0000181421.214.283
MDP0000181421.214.283MDP0000667053
Manihot esculentacassava4.1_013993mcassava4.1_015848mcassava4.1_016492mcassava4.1_016498mcassava4.1_016478m
cassava4.1_030159mcassava4.1_016500m
Medicago truncatulaMedtr5g019620.1Medtr2g081810.1Medtr5g070030.1Medtr2g011080.1Medtr2g011080.2
Mimulus guttatusmgv1a011919mmgv1a026744mmgv1a014007mmgv1a013996mmgv1a014020m
mgv1a013995m
Oryza sativaLOC_Os01g57570.1LOC_Os05g42190.1LOC_Os08g04460.1LOC_Os03g53730.1LOC_Os01g57570.2
LOC_Os08g04460.2
Panicum virgatumPavirv00064613mPavirv00046437mPavirv00014837mPavirv00023949mPavirv00031126m
Pavirv00039933mPavirv00036713mPavirv00019037m
Physcomitrella patensPp1s475_5V6.5Pp1s475_5V6.4Pp1s475_5V6.3Pp1s475_5V6.2Pp1s475_5V6.1
Pp1s32_160V6.1Pp1s55_98V6.1Pp1s352_29V6.1Pp1s227_23V6.1Pp1s114_114V6.1
Pp1s270_78V6.1
Phaseolus vulgarisPhvul.002G027100.1Phvul.011G047200.1Phvul.011G152500.1Phvul.005G088900.1Phvul.005G088900.2
Phvul.006G194800.1Phvul.002G219700.1Phvul.006G194900.1Phvul.008G262200.1Phvul.011G152900.1
Phvul.005G088900.3Phvul.011G152800.1Phvul.011G153100.1
Picea abiesMA_125690g0020MA_10426786g0010MA_10434600g0010MA_206492g0010MA_159008g0220
MA_28841g0010MA_479276g0010
Populus trichocarpaPotri.007G029600.1Potri.005G126200.1Potri.004G151100.1Potri.001G410700.1Potri.011G129400.2
Potri.011G129400.1Potri.004G028900.1Potri.011G033100.1Potri.009G044400.7Potri.009G044400.6
Potri.009G044400.5Potri.009G044400.1Potri.009G044400.4Potri.009G044400.2Potri.011G033100.2
Potri.009G044400.3
Prunus persicappa011578mppa010049mppa011617mppa011600mppa011625m
ppa011865m
Ricinus communis29646.m00106529851.m00244127733.m00003229842.m00370529681.m001326
Setaria italicaSi037123mSi023271mSi015648mSi002660mSi031096m
Selaginella moellendorffii229897232063
Sorghum bicolorSb01g021290.2Sb01g021290.1Sb03g036660.1Sb02g000630.1Sb09g024730.2
Sb09g024730.1Sb02g006210.1Sb03g036660.2Sb04g023400.1
Thellungiella halophilaThhalv10025964mThhalv10014706mThhalv10026307mThhalv10014693mThhalv10014690m
Thhalv10014688m
Vitis viniferaGSVIVT01031920001GSVIVT01014540001GSVIVT01005305001GSVIVT01019014001GSVIVT01005278001
GSVIVT01005303001GSVIVT01024768001
Volvox carteriVocar20014747m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)