CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_001701m
FamilyGH13
Protein PropertiesLength: 834 Molecular Weight: 95605.4 Isoelectric Point: 5.7044
ChromosomeChromosome/Scaffold: 12513 Start: 202686 End: 222012
Descriptionstarch branching enzyme 2.2
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH133406607.5e-28
  LPRIKKLGYNAVQLMAIQEHSYYASFGYHVTNFYAASSRFGTPDDLKSLIDKAHELDLLVLMDIVHSHASTNTLDGLNMFDGTDGHYFHSGPRGHHWMWD
  SRLFNYGSWEVLRFLLSNARWWLDEYKFDGFRFDGVTSMMYTHHGLQVDFTGNYNEYFGYATDVDAVVYLMLLNDMIHGLFPEAVTIGEDVSGMPTVCIP
  VEDGGVGFDYRLHMAVADKWVEIIQKRDEDWKMGDIVHMLTNRRWLEKCVSYAESHDQALVGDKTIAFWLMDKDMYDFMALDRPSTPLIDRGVALHKMIR
  LITMGLGGEGYLNFMGNEFGH
Full Sequence
Protein Sequence     Length: 834     Download
MGHYTISGIR FPCAPLCKSQ STGFHGDRRT SSCLSFNFKK EAFSRRVFSG KSSHESDSSN    60
VMVTASKRVL PDGRIECYSS STDQLEAPGT VSEESQVLTD VESLIMDDKI VEDEVNKESV    120
PMRETVSIRK IGSKPRSIPP PGRGQRIYDI DPSLTGFRQH LDYRYSQYKR LREEIDKYEG    180
SLDAFSRGYE KFGFSRSETG ITYREWAPGA TWAALIGDFN NWNPNADVMT QNECGVWEIF    240
LPNNADGSPP IPHGSRVKIR MDTPSGNKDS IPAWIKFSVQ APGELPYNGI YYDPPEEEKY    300
VFKNPQPKRP KSLRIYESHV GMSSTEPVIN TYANFRDDVL PRIKKLGYNA VQLMAIQEHS    360
YYASFGYHVT NFYAASSRFG TPDDLKSLID KAHELDLLVL MDIVHSHAST NTLDGLNMFD    420
GTDGHYFHSG PRGHHWMWDS RLFNYGSWEV LRFLLSNARW WLDEYKFDGF RFDGVTSMMY    480
THHGLQVDFT GNYNEYFGYA TDVDAVVYLM LLNDMIHGLF PEAVTIGEDV SGMPTVCIPV    540
EDGGVGFDYR LHMAVADKWV EIIQKRDEDW KMGDIVHMLT NRRWLEKCVS YAESHDQALV    600
GDKTIAFWLM DKDMYDFMAL DRPSTPLIDR GVALHKMIRL ITMGLGGEGY LNFMGNEFGH    660
PEWIDFPRGD LHLPSGKFVP GNNYSYDKCR RRFDLHLRYH GMQEFDQAIQ HLEEAYGFMT    720
SEHQYISRKD ERDRIIVFER GNLVFVFNFH WTSSYSDYRV GCLKPGKYKI VLDSDDPLFG    780
GFGRLSHDAE HFSFEGWYDN RPRSFMVYTP CRTAVVYALV EDEVENEVEP VAG*          840
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02960PLN029607.0e-1015722469+
PLN03244PLN032442.0e-138249819582+
PLN02447PLN02447064819764+
cd11321AmyAc_bac_euk_BE0296707417+
PLN02960PLN029600249819577+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABN05322.1018251829starch branching enzyme II [Populus trichocarpa]
GenBankABO31358.1058214840starch branching enzyme II-1 [Malus x domestica]
GenBankACA35286.1048253874starch branching enzyme I [Cucumis sativus]
RefSeqXP_002326414.101078253726predicted protein [Populus trichocarpa]
RefSeqXP_002534111.1018261843starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A014782513698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B014782513698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A014782513698A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A014782513698A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D019978125577A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7945366831418190
HO7776386271978190
HO4581233934308180
HO4581232961414290
HO777638471501960.0000000001
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_004366mcassava4.1_003773mcassava4.1_001686mcassava4.1_002337m
cassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598mcassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)