y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_003747m
FamilyGH47
Protein PropertiesLength: 619 Molecular Weight: 68785.2 Isoelectric Point: 4.8593
ChromosomeChromosome/Scaffold: 10563 Start: 432338 End: 442599
DescriptionGlycosyl hydrolase family 47 protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH47504750
  MFYHAFDGYMEHAFPLDELRPLSCEGEDTLGGYALTLIDSLDTLALLGDREHFTSSVEWIGKNLRFDINKTVSVFETTIRVLGGLLSAHLIASDYATGMR
  IPSYDNQLLALAEDLAQRILPAFDTPTGIPFGSVNLLHGVDEHESKITSTAGGGTLTLEFGVLSQLTNNPIYEQVTKNAVRGLWARRSRLNLVGAHINVF
  TGEWTQKDAGIGTSIDSFYEYLLKAYMLFGDEEYLFIFQEAYTAAMHYLYNDPWYVEVNMDSAAIVWPLFNSLQAFWPGLQVLAGDIEPAIRTHAAFFSV
  WRRYGFTPEGFNLATLSVQHGQKSYPLRPELIESTYWLYKATRDPRYLDAGRDMVASLQYGARCPCGYCHISDVEFHKKEDHMESFFLAETVKYLWLLFD
  LASGPDNLVENGPYKYIFTTEGHLLP
Full Sequence
Protein Sequence     Length: 619     Download
MEKPLKLSIQ FFFLLSILSP QHNLLFIHTA LADGVTSLEA KLLRDEVREM FYHAFDGYME    60
HAFPLDELRP LSCEGEDTLG GYALTLIDSL DTLALLGDRE HFTSSVEWIG KNLRFDINKT    120
VSVFETTIRV LGGLLSAHLI ASDYATGMRI PSYDNQLLAL AEDLAQRILP AFDTPTGIPF    180
GSVNLLHGVD EHESKITSTA GGGTLTLEFG VLSQLTNNPI YEQVTKNAVR GLWARRSRLN    240
LVGAHINVFT GEWTQKDAGI GTSIDSFYEY LLKAYMLFGD EEYLFIFQEA YTAAMHYLYN    300
DPWYVEVNMD SAAIVWPLFN SLQAFWPGLQ VLAGDIEPAI RTHAAFFSVW RRYGFTPEGF    360
NLATLSVQHG QKSYPLRPEL IESTYWLYKA TRDPRYLDAG RDMVASLQYG ARCPCGYCHI    420
SDVEFHKKED HMESFFLAET VKYLWLLFDL ASGPDNLVEN GPYKYIFTTE GHLLPTTPQI    480
SMVGEHCSYF GAYCKSGGNE QESPKSDVSL NPQGTNASTS YGGQVHTGYP LDSTFFESTA    540
TSGLMKGICP GLTHGQKYGI SYVDLIDTAQ EDKSTHQSEN AAKSHSPRVV SDQTAGSSLS    600
NNNDRGGNVH ESSERGSE*                                                 660
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PTZ00470PTZ004702.0e-7744479478+
pfam01532Glyco_hydro_478.0e-17250475461+
Gene Ontology
GO TermDescription
GO:0004571mannosyl-oligosaccharide 1,2-alpha-mannosidase activity
GO:0005509calcium ion binding
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI26354.103358828610unnamed protein product [Vitis vinifera]
RefSeqNP_199184.102859525576glycoside hydrolase family 47 protein [Arabidopsis thaliana]
RefSeqXP_002280131.103359528583PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002311656.10325951564predicted protein [Populus trichocarpa]
RefSeqXP_002517026.1016031600Mannosyl-oligosaccharide 1,2-alpha-mannosidase IA, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4ayr_A0314481413A Chain A, Sevenfold Mutant Of Barley Beta-Amylase
PDB4ayq_A0314481413A Chain A, Sevenfold Mutant Of Barley Beta-Amylase
PDB4ayp_A0314481413A Chain A, Sevenfold Mutant Of Barley Beta-Amylase
PDB4ayo_A0314481413A Chain A, Structure Of The Gh47 Processing Alpha-1,2-mannosidase From Caulobacter Strain K31
PDB1fo3_A04747514455A Chain A, Structure Of The Gh47 Processing Alpha-1,2-mannosidase From Caulobacter Strain K31
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
EL4456633141264390
EE5932152732465180
GO3682722922064970
EY1008092671414070
DK4835932612024620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00031.1Aquca_018_00031.2Aquca_018_00031.3Aquca_125_00025.1Aquca_125_00025.2
Aquca_125_00025.3Aquca_125_00025.4Aquca_049_00074.1Aquca_002_00310.1Aquca_125_00025.5
Aquca_002_00310.2
Arabidopsis lyrata479633474272890537494638472957
Arabidopsis thalianaAT3G21160.1AT1G51590.1AT1G51590.2AT1G30000.1AT5G43710.1
AT1G27520.1
Brachypodium distachyonBradi5g20920.1Bradi2g32570.1Bradi2g51467.1Bradi3g59640.1
Brassica rapaBra001816Bra014291Bra018917Bra031256Bra010804
Bra032351Bra032833Bra035984
Carica papayaevm.model.supercontig_95.2evm.model.supercontig_166.13evm.model.supercontig_95.1evm.model.supercontig_67.12evm.model.supercontig_110.19
evm.model.supercontig_58.25
Capsella rubellaCarubv10008737mCarubv10013330mCarubv10008589mCarubv10028673mCarubv10008651m
Chlamydomonas reinhardtiiCre07.g336600.t2.1Cre07.g336600.t1.3Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.289.614Cre06.g301600.t1.3.61.154
Cre06.g301600.t1.3.61.154
Citrus clementinaCiclev10025230mCiclev10014607mCiclev10019471mCiclev10004553m
Citrus sinensisorange1.1g008341morange1.1g008300morange1.1g008122morange1.1g047597m
Cucumis sativusCucsa.359580.9Cucsa.359580.8Cucsa.359580.1Cucsa.047700.1Cucsa.197180.1
Cucsa.254850.1Cucsa.197180.2
Eucalyptus grandisEucgr.F04021.3Eucgr.F04021.2Eucgr.F04021.1Eucgr.C00102.1Eucgr.D00298.2
Eucgr.D00298.1Eucgr.B00341.1Eucgr.H00217.1Eucgr.D00298.3.295.528Eucgr.D00298.3.295.528
Eucgr.D00298.3.92.294Eucgr.D00298.3.92.294
Fragaria vescamrna30596.1-v1.0-hybridmrna05270.1-v1.0-hybrid.98.305mrna05270.1-v1.0-hybrid.98.305mrna17280.1-v1.0-hybrid.95.302mrna17280.1-v1.0-hybrid.95.302
mrna05270.1-v1.0-hybrid.306.507mrna05270.1-v1.0-hybrid.306.507mrna17280.1-v1.0-hybrid.303.483mrna17280.1-v1.0-hybrid.303.483mrna32588.1-v1.0-hybrid
mrna09481.1-v1.0-hybrid.43.302mrna09481.1-v1.0-hybrid.43.302mrna29049.1-v1.0-hybridmrna09481.1-v1.0-hybrid.302.439mrna09481.1-v1.0-hybrid.302.439
Glycine maxGlyma07g02290.1Glyma08g23730.1Glyma17g06600.2Glyma17g06600.1Glyma13g00470.2
Glyma15g10130.1Glyma13g28910.1Glyma13g28910.2Glyma05g01830.1Glyma10g32320.1
Glyma17g10060.1Glyma17g10060.3Glyma17g10060.2Glyma05g22295.1Glyma20g35290.1
Gossypium raimondiiGorai.005G122200.2Gorai.005G122200.1Gorai.011G003500.6Gorai.011G003500.2Gorai.011G003500.1
Gorai.011G003500.3Gorai.011G003500.4Gorai.011G003500.5Gorai.010G238600.1Gorai.009G155100.5
Gorai.009G155100.2Gorai.009G155100.1Gorai.009G155100.4Gorai.009G155100.3Gorai.006G187900.2
Gorai.006G187900.1Gorai.006G245800.2Gorai.006G245800.1Gorai.006G187900.3Gorai.006G187900.4
Linum usitatissimumLus10034820Lus10035727Lus10037312Lus10042830Lus10033368.153.381
Lus10033368.153.381Lus10028127Lus10042143Lus10033368.428.563Lus10033368.428.563
Lus10041170Lus10021888.49.301Lus10021888.49.301Lus10004233Lus10021888.303.456
Lus10021888.303.456
Malus domesticaMDP0000857857MDP0000308427MDP0000143766MDP0000156362.354.619MDP0000156362.354.619
MDP0000167309MDP0000316328MDP0000156362.225.356MDP0000156362.225.356MDP0000268730.351.588
MDP0000268730.351.588MDP0000268730.596.800MDP0000268730.596.800MDP0000230215MDP0000208346
MDP0000245188.48.176MDP0000245188.48.176MDP0000319401.48.275MDP0000319401.48.275MDP0000319401.311.449
MDP0000319401.311.449MDP0000245188.210.319MDP0000245188.210.319MDP0000222952
Manihot esculentacassava4.1_026203mcassava4.1_003593mcassava4.1_003599mcassava4.1_011906mcassava4.1_015511m
cassava4.1_004429m
Medicago truncatulaMedtr4g127310.1Medtr2g019520.2Medtr2g019520.1Medtr2g019520.3Medtr4g106370.1
Medtr1g093270.1
Mimulus guttatusmgv1a003772mmgv1a002872mmgv1a025048mmgv1a002884m
Oryza sativaLOC_Os04g51690.1LOC_Os05g11850.1LOC_Os01g56670.1LOC_Os01g56670.3LOC_Os01g56670.2
LOC_Os02g50780.1LOC_Os01g56670.4
Panicum virgatumPavirv00024177mPavirv00056286mPavirv00057415mPavirv00052269mPavirv00016853m
Pavirv00054954mPavirv00016455mPavirv00000605mPavirv00017739m
Physcomitrella patensPp1s387_34V6.1Pp1s16_48V6.1Pp1s58_280V6.1Pp1s313_34V6.1
Phaseolus vulgarisPhvul.008G254800.1Phvul.003G140700.1Phvul.006G164400.1Phvul.003G197300.1Phvul.007G109800.1
Phvul.006G033000.1Phvul.011G127200.1
Picea abiesMA_10430881g0010MA_10426596g0010MA_311901g0010MA_10180832g0010MA_170877g0010
MA_8281735g0010MA_118584g0010
Populus trichocarpaPotri.018G141100.2Potri.018G141100.1Potri.008G007500.1Potri.008G007500.2Potri.018G141100.3
Potri.018G141100.4Potri.004G132300.1Potri.004G132300.2Potri.004G132300.4Potri.004G132300.3
Potri.015G071400.1Potri.012G076600.1Potri.008G160900.1Potri.015G071400.2Potri.012G076600.2
Prunus persicappa004310mppa026880mppa002795mppa003534mppa002909m
ppa012357m
Ricinus communis28359.m00028030063.m00145129693.m00202130147.m01400429844.m003177
Setaria italicaSi013487mSi009718mSi021445mSi016751mSi004250m
Selaginella moellendorffii1013518511116848592622229806
228194
Sorghum bicolorSb06g027810.1Sb09g006500.1Sb03g036080.1Sb04g028330.1
Thellungiella halophilaThhalv10011358mThhalv10020383mThhalv10007084mThhalv10003168mThhalv10007201m
Vitis viniferaGSVIVT01029601001GSVIVT01029306001GSVIVT01029623001GSVIVT01021446001GSVIVT01007818001
GSVIVT01018097001GSVIVT01029609001
Volvox carteriVocar20012263m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)