CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_004366m
FamilyGH13
Protein PropertiesLength: 581 Molecular Weight: 67219.9 Isoelectric Point: 6.4514
ChromosomeChromosome/Scaffold: 06550 Start: 445392 End: 463520
Descriptionstarch branching enzyme 2.2
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH131124333.1e-30
  LPRIKKLGYNAVQIMAIQEHSYYASFGYHVTNFFAPSSRFGTPDDLKSLIDKAHELGLLVLMDVVHSHASNNTLDGLNMFDGTDSHYFHSGSRGHHWLWD
  SRLFNYGSWEVLRFLLSNARWWLEEYRFDGFRFDGVTSMMYTHHGLQVAFTGNYNEYFGYATDVDAVIYLMLVNDMIHGLFPEAVTIGEDVSGKPTFCIP
  VEDGGVGFDYRLHMAIADKWIEILKKRDEDWKMGDIVHTLTNRRWLEKCVAYAESHDQALVGDKTIAFWLMDKDMYDFMARDRPSTPLIDRGIALHKMIR
  LITMGLGGEGYLNFMGNEFGHP
Full Sequence
Protein Sequence     Length: 581     Download
MTRNEFGVWE IFLPNNADGS PPIPHGSRVK IRMDTPSGIK DSIPAWIKFS VQAPGEIPYN    60
AIYYDPPKEE KYVFKHPQPK RPKSLRIYES HVGMSSTEPI INTYANFRDD MLPRIKKLGY    120
NAVQIMAIQE HSYYASFGYH VTNFFAPSSR FGTPDDLKSL IDKAHELGLL VLMDVVHSHA    180
SNNTLDGLNM FDGTDSHYFH SGSRGHHWLW DSRLFNYGSW EVLRFLLSNA RWWLEEYRFD    240
GFRFDGVTSM MYTHHGLQVA FTGNYNEYFG YATDVDAVIY LMLVNDMIHG LFPEAVTIGE    300
DVSGKPTFCI PVEDGGVGFD YRLHMAIADK WIEILKKRDE DWKMGDIVHT LTNRRWLEKC    360
VAYAESHDQA LVGDKTIAFW LMDKDMYDFM ARDRPSTPLI DRGIALHKMI RLITMGLGGE    420
GYLNFMGNEF GHPEWIDFPR GDRHLPNGKV IPGNNHSYDK CRRRFDLGDA DYLRYHGMQE    480
FDQAMQHLEE AYGFMTSEHQ YISRKDEGDR IIVFERGNLV FVFNFHWTNS YSDYRVGCFK    540
SGKYKIVLDS DDGLFGGFNR LSHDAEHFTF VRKFGRDFTT * 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0296GlgB4.0e-1043560567+
PLN03244PLN032442.0e-14021557541+
PLN02447PLN0244701569573+
cd11321AmyAc_bac_euk_BE069483416+
PLN02960PLN02960021564547+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0004553hydrolase activity, hydrolyzing O-glycosyl compounds
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankAAT76444.101569234802starch branching enzyme II [Vigna radiata]
GenBankABN05322.101569229797starch branching enzyme II [Populus trichocarpa]
EMBLCAA56319.101569250818starch branching enzyme I [Pisum sativum]
RefSeqXP_002326414.101569126694predicted protein [Populus trichocarpa]
RefSeqXP_002534111.101570242811starch branching enzyme II, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3amk_A0156995658A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB3vu2_B0156995658A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3vu2_A0156995658A Chain A, Structure Of The Starch Branching Enzyme I (bei) Complexed With Maltopentaose From Oryza Sativa L
PDB3aml_A0156995658A Chain A, Structure Of The Starch Branching Enzyme I (Bei) From Oryza Sativa L
PDB1m7x_D1e-38357658596A Chain A, The X-Ray Crystallographic Structure Of Branching Enzyme
Metabolic Pathways
Pathway NameReactionECProtein Name
starch biosynthesisRXN-7710EC-2.4.1.181,4-α-glucan branching enzyme
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77763856915690
HO79453656915690
HO4581233682025690
HO45812320112010
HO61916757435690
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_066_00053.1Aquca_027_00415.5Aquca_027_00415.4Aquca_027_00415.3Aquca_027_00415.2
Aquca_027_00415.1Aquca_015_00400.6Aquca_015_00400.5Aquca_015_00400.2Aquca_015_00400.1
Aquca_015_00400.3Aquca_015_00400.4
Arabidopsis lyrata873536321348908239
Arabidopsis thalianaAT3G20440.3AT3G20440.2AT2G36390.1AT5G03650.1
Brachypodium distachyonBradi1g41970.2Bradi1g41970.1Bradi1g29850.2Bradi1g29850.1Bradi5g09170.2
Bradi5g09170.1Bradi3g44760.1
Brassica rapaBra035782Bra005269Bra017241Bra009521
Carica papayaevm.model.supercontig_5.62
Capsella rubellaCarubv10012936mCarubv10022617mCarubv10000235m
Chlamydomonas reinhardtiiCre06.g270100.t1.3Cre10.g444700.t1.1Cre06.g289850.t1.3Cre08.g373450.t1.1
Citrus clementinaCiclev10007401mCiclev10011063mCiclev10000406mCiclev10000374mCiclev10000272m
Ciclev10000256m
Citrus sinensisorange1.1g035501morange1.1g002609morange1.1g004765morange1.1g004253morange1.1g003474m
orange1.1g003390morange1.1g003230morange1.1g003226m
Cucumis sativusCucsa.378410.2Cucsa.378410.1Cucsa.077550.3Cucsa.077550.1Cucsa.077550.2
Eucalyptus grandisEucgr.F03487.1Eucgr.A01533.1Eucgr.F01770.1
Fragaria vescamrna30233.1-v1.0-hybridmrna08644.1-v1.0-hybridmrna08646.1-v1.0-hybrid
Glycine maxGlyma18g10385.1Glyma03g35020.2Glyma03g35020.1Glyma19g37750.2Glyma19g37750.1
Glyma04g01950.2
Gossypium raimondiiGorai.009G406400.4Gorai.011G196000.5Gorai.011G196000.4Gorai.011G196000.3Gorai.011G196000.2
Gorai.011G196000.12Gorai.011G196000.1Gorai.011G196000.7Gorai.011G196000.6Gorai.011G196000.13
Gorai.002G172100.7Gorai.002G172100.5Gorai.002G172100.3Gorai.002G172100.2Gorai.002G172100.1
Gorai.009G441800.2Gorai.009G441800.1Gorai.009G406400.6Gorai.009G406400.5Gorai.009G406400.3
Gorai.009G406400.2Gorai.009G406400.1Gorai.002G241400.7Gorai.002G241400.6Gorai.002G241400.5
Gorai.002G241400.4Gorai.002G241400.2Gorai.002G241400.1Gorai.005G113800.3Gorai.005G113800.2
Gorai.005G113800.1
Linum usitatissimumLus10000912Lus10023878Lus10014382Lus10016012Lus10012264
Malus domesticaMDP0000218396MDP0000148418MDP0000214735MDP0000177786
Manihot esculentacassava4.1_006199mcassava4.1_003773mcassava4.1_001701mcassava4.1_001686mcassava4.1_002337m
cassava4.1_002172mcassava4.1_002171mcassava4.1_001826mcassava4.1_001598mcassava4.1_001595m
Medicago truncatulaMedtr7g104080.1
Mimulus guttatusmgv1a001162mmgv1a001301mmgv1a001932m
Oryza sativaLOC_Os02g32660.2LOC_Os06g26234.3LOC_Os06g26234.2LOC_Os06g26234.1LOC_Os02g32660.1
LOC_Os06g51084.8LOC_Os06g51084.7LOC_Os06g51084.6LOC_Os06g51084.5LOC_Os06g51084.4
LOC_Os06g51084.3LOC_Os06g51084.2LOC_Os06g51084.1
Panicum virgatumPavirv00035568mPavirv00058932mPavirv00002278mPavirv00067040mPavirv00061484m
Pavirv00061483mPavirv00061485m
Physcomitrella patensPp1s200_23V6.1Pp1s15_181V6.2Pp1s15_181V6.1Pp1s54_189V6.2Pp1s54_189V6.1
Pp1s64_78V6.1
Phaseolus vulgarisPhvul.006G047000.1Phvul.001G187600.1Phvul.009G011000.1
Picea abiesMA_10430611g0010
Populus trichocarpaPotri.006G115100.5Potri.001G359200.1Potri.006G115100.6Potri.006G115100.4Potri.006G115100.3
Potri.006G115100.2Potri.006G115100.1Potri.005G251000.5Potri.005G251000.4Potri.005G251000.3
Potri.005G251000.2Potri.005G251000.1Potri.005G251000.6
Prunus persicappa016544mppa001312mppa001929m
Ricinus communis29762.m00048630170.m01435927496.m000095
Setaria italicaSi008087mSi016350mSi009379mSi009312mSi005911m
Si006006mSi006081m
Selaginella moellendorffii165481437348437417
Sorghum bicolorSb03g027310.1Sb04g021540.1Sb06g015360.1Sb10g030776.1
Thellungiella halophilaThhalv10020019mThhalv10016249mThhalv10012785mThhalv10012784mThhalv10012679m
Vitis viniferaGSVIVT01037695001GSVIVT01033801001GSVIVT01008673001
Volvox carteriVocar20012173mVocar20015251mVocar20002436mVocar20007338m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)