y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_004527m
FamilyCE8
Protein PropertiesLength: 571 Molecular Weight: 62516.5 Isoelectric Point: 7.8636
ChromosomeChromosome/Scaffold: 06948 Start: 407184 End: 409346
DescriptionPlant invertase/pectin methylesterase inhibitor superfamily
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE82595600
  TVCKNVSSGCYGTVQEAVNAAPNATERRFVIHIKEGVYEEIVRIPFEKKNVVFLGDGMGKTIITGSLSVAQPGVTTYESATVGVLGDGFMASGITFQNAA
  GPPTYQAVAFRSDSDLSYIENCEFLGNQDTLYAHSLRQFYKSCRIQGNVDFIFGNSAAVFQDCQILIVPRQENPEKGEQNTVTAHGRTDPAQSTGFVFQN
  CSISGTAEYMALYNSNPKVHKNYLGRPWKEYSRVVYINCSFEALISAEGWMPWNGDFALTTLYYGEYKNSGPGSNLSERVTWSSQIPAEHVNTYSVQSFI
  QG
Full Sequence
Protein Sequence     Length: 571     Download
MTAPTTTSRK NFRRSKSKRL LVIIIVALLL LSLIGVVLFF TLRHKISDSH SPKSSSSSKV    60
PVAAIQLACQ ATQHPETCQT SLYQSNIVPP NPTPVQIIQS ALWVSSQNLS IAQSMLKSLL    120
ASAAGNQNIT NVAKSCLEIL GFSQYRSSVS NNTLPFGKSK NVRAWMSAAV AYQYDCYGGL    180
GYHGGNSQEI NKTRAFLEDL ITLSSNALSM IVSYDLFGNE TRSWRPPKTE RDGFWEDPKL    240
GGGIGFRSEF PSNLTVDATV CKNVSSGCYG TVQEAVNAAP NATERRFVIH IKEGVYEEIV    300
RIPFEKKNVV FLGDGMGKTI ITGSLSVAQP GVTTYESATV GVLGDGFMAS GITFQNAAGP    360
PTYQAVAFRS DSDLSYIENC EFLGNQDTLY AHSLRQFYKS CRIQGNVDFI FGNSAAVFQD    420
CQILIVPRQE NPEKGEQNTV TAHGRTDPAQ STGFVFQNCS ISGTAEYMAL YNSNPKVHKN    480
YLGRPWKEYS RVVYINCSFE ALISAEGWMP WNGDFALTTL YYGEYKNSGP GSNLSERVTW    540
SSQIPAEHVN TYSVQSFIQG DEWMPTSASS *                                   600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PLN02301PLN023013.0e-114136570453+
PLN02201PLN022012.0e-11669567537+
PLN02713PLN027131.0e-11668568549+
pfam01095Pectinesterase2.0e-161257561308+
PLN02708PLN02708066568508+
Gene Ontology
GO TermDescription
GO:0004857enzyme inhibitor activity
GO:0005618cell wall
GO:0030599pectinesterase activity
GO:0042545cell wall modification
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002275192.105156526541PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002281640.105156839555PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002306241.105256842558predicted protein [Populus trichocarpa]
RefSeqXP_002309906.105256845564predicted protein [Populus trichocarpa]
RefSeqXP_002517239.104156822552Pectinesterase-2 precursor, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1gq8_A026656416308A Chain A, Pectin Methylesterase From Carrot
PDB1xg2_A02545681308B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_B9e-202555663340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntq_A9e-202555663340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
PDB2ntp_B9e-202555663340B Chain B, Crystal Structure Of The Complex Between Pectin Methylesterase And Its Inhibitor Protein
Metabolic Pathways
Pathway NameReactionECProtein Name
homogalacturonan degradationRXN-2102EC-3.1.1.11pectinesterase
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7451542812895690
EX6715762772905660
EC9561722683015680
JK3177772503185670
DT5713562672605240
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_1260_00001.1Aquca_022_00312.1
Arabidopsis lyrata919784325521
Arabidopsis thalianaAT5G09760.1AT5G64640.1
Brachypodium distachyonBradi2g56820.1Bradi5g10700.1
Brassica rapaBra024317Bra028619Bra037786Bra006031Bra009401
Bra028617Bra009400Bra002149
Carica papayaevm.model.supercontig_42.121
Capsella rubellaCarubv10026126mCarubv10000564m
Citrus clementinaCiclev10025271m
Citrus sinensisorange1.1g009085m
Cucumis sativusCucsa.249950.1
Eucalyptus grandisEucgr.H04944.1
Fragaria vescamrna26037.1-v1.0-hybridmrna17879.1-v1.0-hybrid
Glycine maxGlyma05g32380.1Glyma08g15650.1Glyma06g15711.1
Gossypium raimondiiGorai.011G116400.1Gorai.003G067900.1Gorai.007G064900.1
Linum usitatissimumLus10013721Lus10033486Lus10020888Lus10005587
Malus domesticaMDP0000196867MDP0000200773MDP0000233370MDP0000297071MDP0000174996
MDP0000204084MDP0000173284MDP0000174791
Manihot esculentacassava4.1_006847mcassava4.1_004459mcassava4.1_021091mcassava4.1_005773m
Medicago truncatulaMedtr8g093460.1Medtr3g095920.1
Mimulus guttatusmgv1a004027mmgv1a008938mmgv1a007669mmgv1a003977mmgv1a019250m
Oryza sativaLOC_Os01g65790.1LOC_Os04g35770.1
Panicum virgatumPavirv00054696mPavirv00008464mPavirv00032807mPavirv00008364m
Physcomitrella patensPp1s382_22V6.1Pp1s216_42V6.1Pp1s151_23V6.2Pp1s76_125V6.1Pp1s151_23V6.1
Phaseolus vulgarisPhvul.002G270900.1Phvul.009G148900.1
Picea abiesMA_10430460g0010.462.762MA_10427058g0010.383.512MA_10427058g0010.383.512MA_10427058g0010.79.248MA_10427058g0010.79.248
MA_906551g0010MA_2253g0010MA_54974g0010MA_68362g0010MA_10430460g0010.462.762
MA_67675g0010MA_495624g0010
Populus trichocarpaPotri.005G061500.1Potri.007G107300.2Potri.007G107300.3Potri.007G107300.1
Prunus persicappa021056mppa024386mppa003915m
Ricinus communis30136.m001028
Setaria italicaSi005458mSi010057m
Selaginella moellendorffii8374476314420760
Sorghum bicolorSb06g017280.1Sb03g041680.1
Thellungiella halophilaThhalv10013067mThhalv10003853m
Vitis viniferaGSVIVT01026518001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)