CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_004771m
FamilyGH13
Protein PropertiesLength: 559 Molecular Weight: 62160.6 Isoelectric Point: 6.4619
ChromosomeChromosome/Scaffold: 00224 Start: 15930 End: 35895
Descriptionlimit dextrinase
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH13163646.6e-29
  ITAFQNDDGYNWGYNPVLWGVPKGSYASNPNGSCRTIEFRKMVQAINRIGLRVVLDVVYNHLHGSGPFDENSVLDKVVPGYYLRRNSDGFIENSTCVNNT
  ASEHYMVERLIVDDLLSWAVNYKIDGFRFDLMGHMMKSTMVKAKDALLSLTKERNGVDGSSIYLYGEGWDFGEVAKNARGINASQFNLGGTGIGSFNDRI
  RDAMHGGSPFGHPLQQGFVTGLMLQPNGHDHGGKDVEEHMLTIAKDHIQAGMAANLREFVLINSEGKEVKGSEILTYGGEPLAYALCPTETINYVSAHDN
  ETLFDVVCMKTPMQISVDERCRLNYLATNMIALAQGIPFFHAGDEMLRS
Full Sequence
Protein Sequence     Length: 559     Download
MLEKLPPDSA EQQAHITAFQ NDDGYNWGYN PVLWGVPKGS YASNPNGSCR TIEFRKMVQA    60
INRIGLRVVL DVVYNHLHGS GPFDENSVLD KVVPGYYLRR NSDGFIENST CVNNTASEHY    120
MVERLIVDDL LSWAVNYKID GFRFDLMGHM MKSTMVKAKD ALLSLTKERN GVDGSSIYLY    180
GEGWDFGEVA KNARGINASQ FNLGGTGIGS FNDRIRDAMH GGSPFGHPLQ QGFVTGLMLQ    240
PNGHDHGGKD VEEHMLTIAK DHIQAGMAAN LREFVLINSE GKEVKGSEIL TYGGEPLAYA    300
LCPTETINYV SAHDNETLFD VVCMKTPMQI SVDERCRLNY LATNMIALAQ GIPFFHAGDE    360
MLRSKSLDRD SYNSGDWFNR LDFSYNSNNW GVGLPPKGKN EGNWPLMKPR LADPSFKPQK    420
SHILATVDNF LDVLQIRYSS PLFRLTTANA IQERVRFHNT GPSWVPGVIV MSIEDGHEGF    480
PGLSQLDPIY SYIVVIFNTC PNEILFACPP LRARGFQLHP VQVKSTDKVV KKSAYEPLSG    540
CFTVPPMTTS VFVEPRKI* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam11852DUF33728.0e-85384556173+
TIGR02104pulA_typeI9.0e-9322509493+
cd11341AmyAc_Pullulanase_LD-like2.0e-14120389373+
PLN02877PLN0287701556556+
TIGR02103pullul_strch01556560+
Gene Ontology
GO TermDescription
GO:0003824catalytic activity
GO:0005975carbohydrate metabolic process
GO:0043169cation binding
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCBI31395.101558399956unnamed protein product [Vitis vinifera]
RefSeqNP_196056.201556408963ATLDA (LIMIT DEXTRINASE); alpha-amylase/ limit dextrinase/ pullulanase [Arabidopsis thaliana]
RefSeqXP_002271820.101558350907PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315334.101556338893predicted protein [Populus trichocarpa]
RefSeqXP_002532780.101556409964pullulanase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB4aio_A02556329883A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi
PDB2y5e_A02556329883A Chain A, Crystal Structure Of The R3 Form Of Pectate Lyase A, Erwinia Chrysanthemi
PDB2y4s_A02556329883A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhf_A085565381070A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
PDB2fhc_A085565381070A Chain A, Barley Limit Dextrinase In Complex With Beta-Cyclodextrin
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1824EC-3.2.1.41pullulanase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CO12834427812780
DV1354572641714340
GO8722433411825220
EH7738472822134940
AM7334102872335190
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_030_00024.1
Arabidopsis lyrata487216
Arabidopsis thalianaAT5G04360.1
Brachypodium distachyonBradi5g00540.2Bradi5g00540.1
Brassica rapaBra009461
Carica papayaevm.model.supercontig_53.158
Capsella rubellaCarubv10000153m
Chlamydomonas reinhardtiiCre11.g476650.t1.3
Citrus clementinaCiclev10031035m
Citrus sinensisorange1.1g002079morange1.1g002161morange1.1g002787m
Cucumis sativusCucsa.308730.1
Eucalyptus grandisEucgr.G02746.1Eucgr.G02746.2
Fragaria vescamrna23425.1-v1.0-hybrid
Glycine maxGlyma10g34080.1
Gossypium raimondiiGorai.009G305300.12Gorai.009G305300.11Gorai.009G305300.1Gorai.009G305300.10Gorai.009G305300.2
Gorai.009G305300.3Gorai.009G305300.4Gorai.009G305300.5Gorai.009G305300.6Gorai.009G305300.7
Gorai.009G305300.9Gorai.009G305300.8
Linum usitatissimumLus10038675
Malus domesticaMDP0000142103
Mimulus guttatusmgv1a001246m
Physcomitrella patensPp1s142_79V6.1.481.888
Phaseolus vulgarisPhvul.007G139400.1
Populus trichocarpaPotri.010G229300.4Potri.010G229300.1Potri.010G229300.2Potri.010G229300.3
Prunus persicappa000905m
Ricinus communis29475.m000230
Setaria italicaSi011852m
Selaginella moellendorffii165275
Sorghum bicolorSb06g001540.1
Thellungiella halophilaThhalv10012585m
Vitis viniferaGSVIVT01016183001
Volvox carteriVocar20014607m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny