y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_004784m
FamilyAA1
Protein PropertiesLength: 558 Molecular Weight: 63571.7 Isoelectric Point: 7.8915
ChromosomeChromosome/Scaffold: 04251 Start: 189391 End: 192183
DescriptionCupredoxin superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
AA1743401.2e-21
  NATVPGPTIEAMHNVDTYVTWKNHLPSKHILPWDPTIPTAIPTTKKGIPTVVHLHGSIGEPESDGHAESWFTNRFAEKGPTWSKKTYHYHNFQQPGNLWY
  HDHAMGLTRVNLLAGLVGAYIIRHPEVEAPLGLPFGDELDRILMVFDRSFRTDGSIYMNSTGNNPSIHPQWQPEYFGDAIIVNGKAWPRLTVRRRKYRFR
  IINASNARFFRFFFTNGLQFIHVAADSVYLEEPVATNETLLAPSEVADVVVDFSKSKSNTVVLANNA
Full Sequence
Protein Sequence     Length: 558     Download
MLTASWAEDS LISPSRLEMF VDELPDMPRI HGFDVVNGVP KPKRLRIGMF KKEWKFHRDL    60
PPTPVFAYGV SKQNATVPGP TIEAMHNVDT YVTWKNHLPS KHILPWDPTI PTAIPTTKKG    120
IPTVVHLHGS IGEPESDGHA ESWFTNRFAE KGPTWSKKTY HYHNFQQPGN LWYHDHAMGL    180
TRVNLLAGLV GAYIIRHPEV EAPLGLPFGD ELDRILMVFD RSFRTDGSIY MNSTGNNPSI    240
HPQWQPEYFG DAIIVNGKAW PRLTVRRRKY RFRIINASNA RFFRFFFTNG LQFIHVAADS    300
VYLEEPVATN ETLLAPSEVA DVVVDFSKSK SNTVVLANNA NYPFPDGDPV NEANGKVMKF    360
IIKQNQEVDT GRVPKKLIAY PSPDLSSVSQ TRYIALYEYV SDTDEPIHLF INAKSYEEPV    420
TETPKEGTTE IWNVINLTED NHPLHIHLGL FVVMDQTKLI NIEQFKACMM KLNDAIKCQI    480
DKYARGKKLK VQPQEKGWKN VYKMTPGYLT KIVVRFAYIH TNASYAFDAT AEPGYVYHCH    540
ILDHEDNVMM RPLKIIH*                                                  600
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
PRK10965PRK109655.0e-6411550144+
pfam07732Cu-oxidase_39.0e-974199128+
PRK10883PRK108832.0e-10166328169+
PRK10965PRK109654.0e-13144331223+
COG2132SufI2.0e-3538555532+
Gene Ontology
GO TermDescription
GO:0005507copper ion binding
GO:0016491oxidoreductase activity
GO:0055114oxidation-reduction process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN78466.10855624572hypothetical protein [Vitis vinifera]
EMBLCBI26921.10155698653unnamed protein product [Vitis vinifera]
RefSeqXP_002284144.10155621576PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002315892.10855624572predicted protein [Populus trichocarpa]
RefSeqXP_002531069.10155619574spore coat protein, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3zdw_A0175553508A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB2x88_A0175553508A Chain A, The Structure Of A Protein In Glycosyl Transferase Family 8 From Anaerococcus Prevotii.
PDB2x87_A0175553508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB2bhf_A0175553508A Chain A, Crystal Structure Of The Reconstituted Cota
PDB1w8e_A0175553508A Chain A, Crystal Structure Of The Reconstituted Cota
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO778093517405560
HO7965214551025560
EY8239072941454380
EY7055082941384310
EL4671113072385440
Orthologous Group
SpeciesID
Arabidopsis lyrata472551
Brassica rapaBra024558Bra016163
Carica papayaevm.model.supercontig_65.123
Capsella rubellaCarubv10020039m
Eucalyptus grandisEucgr.B00864.1Eucgr.B00863.1Eucgr.B00862.1
Glycine maxGlyma20g26270.3Glyma20g26270.2Glyma20g26270.1Glyma10g41010.1
Gossypium raimondiiGorai.005G162700.1
Mimulus guttatusmgv1a004781m
Oryza sativaLOC_Os01g03640.1LOC_Os01g03630.1LOC_Os01g03620.1LOC_Os01g03530.2LOC_Os01g03530.1
Panicum virgatumPavirv00060261mPavirv00051027mPavirv00039074m
Physcomitrella patensPp1s40_48V6.1Pp1s40_48V6.2Pp1s40_48V6.3Pp1s40_48V6.4Pp1s40_48V6.5
Pp1s40_48V6.6
Phaseolus vulgarisPhvul.007G038200.1
Picea abiesMA_64691g0010MA_10432589g0010
Setaria italicaSi005198mSi004323m
Selaginella moellendorffii90700
Sorghum bicolorSb03g007440.1
Thellungiella halophilaThhalv10007182m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny