CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_005468m
FamilyCE10
Protein PropertiesLength: 526 Molecular Weight: 58865.4 Isoelectric Point: 4.7302
ChromosomeChromosome/Scaffold: 03104 Start: 56520 End: 64851
Descriptionalpha/beta-Hydrolases superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
CE102804992.7e-28
  YQASPEEKPPLLLKSHGGPTGETRGILNLSIQYWTSRGWAVVDVNYGGSTGYGREYRERLLGNWGIVDVNDCCSCAKFLVDSGKADGERLCITGGSAGGY
  TTLAALAFKETFKAGASLYGVADLSMLRAETHKFESHYIDNLVGDEKNYFERSPINFVDRFSCPIILFQGLEDKVVPPDQARIIYQALKKKGLPVALVEY
  EGEQHGFRKAENIKFTLEQE
Full Sequence
Protein Sequence     Length: 526     Download
MEDRRVSSMN AITTIVAIGL NDSDIEEPKV LVSGNDFYAF PRMDPKGERI AWIEWGHPNM    60
PWDKSELWVG YISENGDIYK RICVAGNDNK IVESPTEPKW SSTGELFFIT DRRNGFWNLY    120
KWIESVNDVQ ALYSLDAEFS SPLWVFGINS YELIQNKEGR NLIACSYRQK GRSHFGILDC    180
AQSSLSLLDI PFTDINSITL GHHCLYIEGA STIHPSSVAK VILDDQGSKV VDFEIVWSSS    240
PDSLKYTSYF SSPELIEFPT GVVPGQNAYA YFYPPLNPIY QASPEEKPPL LLKSHGGPTG    300
ETRGILNLSI QYWTSRGWAV VDVNYGGSTG YGREYRERLL GNWGIVDVND CCSCAKFLVD    360
SGKADGERLC ITGGSAGGYT TLAALAFKET FKAGASLYGV ADLSMLRAET HKFESHYIDN    420
LVGDEKNYFE RSPINFVDRF SCPIILFQGL EDKVVPPDQA RIIYQALKKK GLPVALVEYE    480
GEQHGFRKAE NIKFTLEQEM VFFARLVGNF NVADDINPIK IDNFD* 
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam12695Abhydrolase_54.0e-8294481191+
COG0657Aes2.0e-9257486261+
COG0412COG04123.0e-10253486244+
pfam00326Peptidase_S92.0e-50310509205+
COG1506DAP24.0e-7427510491+
Gene Ontology
GO TermDescription
GO:0006508proteolysis
GO:0008236serine-type peptidase activity
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_198470.302525207729serine-type peptidase [Arabidopsis thaliana]
RefSeqXP_002284254.102525155677PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002284264.102525153675PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002302446.101525159672predicted protein [Populus trichocarpa]
RefSeqXP_002510270.101523208729acylamino-acid-releasing enzyme, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB3azo_B035508187649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azo_A035508187649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_B035508187649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azq_A035508187649A Chain A, Crystal Structure Of Puromycin Hydrolase
PDB3azp_B035508187649A Chain A, Crystal Structure Of Puromycin Hydrolase S511a Mutant
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO780216430985260
DV7110393091925000
DV7111723031924940
DV7072662971924880
HO78021683261084e-34
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00583.4Aquca_017_00583.3Aquca_017_00583.2Aquca_017_00583.1Aquca_015_00163.1
Arabidopsis lyrata915409859721
Arabidopsis thalianaAT4G14570.1AT5G36210.1
Brachypodium distachyonBradi3g26780.4Bradi3g26780.3Bradi3g26780.2Bradi3g26787.1Bradi1g45890.1
Brassica rapaBra039731Bra036867Bra037063Bra030822
Capsella rubellaCarubv10006608mCarubv10013057mCarubv10012695mCarubv10013077mCarubv10004231m
Chlamydomonas reinhardtiiCre05.g241650.t1.3Cre10.g423300.t1.1
Citrus clementinaCiclev10004377mCiclev10004325mCiclev10003676m
Citrus sinensisorange1.1g005093morange1.1g004149morange1.1g004141morange1.1g003363morange1.1g004816m
orange1.1g004757morange1.1g004756morange1.1g004735m
Cucumis sativusCucsa.386660.1Cucsa.123480.1Cucsa.123460.1
Eucalyptus grandisEucgr.H00222.1Eucgr.H00221.1Eucgr.F00026.5Eucgr.F00026.4Eucgr.F00026.3
Eucgr.F00026.2Eucgr.F00026.1Eucgr.F00028.1Eucgr.F00027.2Eucgr.F00027.1
Eucgr.L02208.1Eucgr.F00027.3Eucgr.F00025.1
Fragaria vescamrna29072.1-v1.0-hybridmrna32579.1-v1.0-hybridmrna09045.1-v1.0-hybridmrna09044.1-v1.0-hybrid
Glycine maxGlyma10g00350.1Glyma10g00320.1Glyma08g42730.1Glyma18g11480.3Glyma18g11480.2
Glyma18g11480.4
Gossypium raimondiiGorai.006G245500.5Gorai.006G245500.4Gorai.006G245500.3Gorai.006G245500.1Gorai.010G016900.1
Linum usitatissimumLus10039405Lus10015363Lus10032765Lus10021758
Malus domesticaMDP0000211874MDP0000304250MDP0000251803
Manihot esculentacassava4.1_002075mcassava4.1_031105m
Medicago truncatulaAC233668_48.1Medtr5g042400.2Medtr5g042400.1Medtr5g042410.1Medtr3g051310.1
Mimulus guttatusmgv1a001402mmgv1a001397mmgv1a002403m
Oryza sativaLOC_Os10g28020.3LOC_Os10g28020.1LOC_Os10g28020.2LOC_Os10g28030.2LOC_Os10g28030.1
LOC_Os06g11180.1
Panicum virgatumPavirv00008779mPavirv00061808mPavirv00015591mPavirv00045661mPavirv00003810m
Pavirv00003809m
Physcomitrella patensPp1s619_3V6.1Pp1s97_68V6.1Pp1s108_134V6.1Pp1s9_317V6.2Pp1s9_317V6.1
Pp1s139_36V6.2Pp1s139_36V6.1
Phaseolus vulgarisPhvul.007G279900.1Phvul.007G280000.1Phvul.006G042600.1Phvul.006G042700.1
Populus trichocarpaPotri.008G160400.1Potri.002G128700.9Potri.002G128700.8Potri.002G128700.7Potri.002G128700.6
Potri.002G128700.5Potri.002G128700.4Potri.002G128700.3Potri.002G128700.2Potri.002G128700.10
Potri.002G128700.1
Prunus persicappa001729mppa002365m
Ricinus communis29844.m00318230170.m01392428323.m000042
Setaria italicaSi034264mSi034356mSi006001mSi005937mSi005954m
Selaginella moellendorffii16830378836
Sorghum bicolorSb01g021970.4Sb01g021970.2Sb01g021970.1Sb01g021970.5Sb01g021960.1
Sb01g021970.3Sb10g007280.1Sb10g007270.1
Thellungiella halophilaThhalv10024477mThhalv10003712m
Vitis viniferaGSVIVT01018091001GSVIVT01009564001GSVIVT01009565001
Volvox carteriVocar20006950m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)