y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_005541m
FamilyGT57
Protein PropertiesLength: 523 Molecular Weight: 60339.2 Isoelectric Point: 9.2805
ChromosomeChromosome/Scaffold: 06871 Start: 537140 End: 542272
DescriptionALG6, ALG8 glycosyltransferase family
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT57445000
  LLVRATVSLHPYSGAGNPPKFGDYEAQRHWMEITINLPVKEWYRNSTNNDLKYWGLDYPPLTAYQSYIHGIFLRYFEPDSVALFTSRGYESYLGKQLMRW
  TVLSSDALIFFPAVLYFVLVYYRNHSSRRKSDVAWHIAMILINPCLILVDHGHFQYNCISLGLTVGAIAAVLSHKDLVASVLFCLSLNHKQMSAYFAPAF
  FSHLLGKCLKHKNPVLEVSKLGLVVLGTFTIIWWPYLNSRDTVMEVLFRLAPFERGIYEDYVANFWCTTSILIKWKRLFTTQSLKFVSLLATVLTFLPSM
  VQQIMAPSRKGFLYALVNSSFSFYLFSFQVHEKSILLPLLPASLLATELRGPFELLMHYALFSMFPLLCRDKLIVPYVALYALFFLLYFTPSGRKDAKIH
  NSTTLTCLSILLTFLYLCSLLLHILYLIIHPPKKYPFLFEAMIMLLCFSHFILFVSY
Full Sequence
Protein Sequence     Length: 523     Download
MEKKGKKKVL KDMADAVNED DDSCWWFVHK GIESSFLCIA VFGLLVRATV SLHPYSGAGN    60
PPKFGDYEAQ RHWMEITINL PVKEWYRNST NNDLKYWGLD YPPLTAYQSY IHGIFLRYFE    120
PDSVALFTSR GYESYLGKQL MRWTVLSSDA LIFFPAVLYF VLVYYRNHSS RRKSDVAWHI    180
AMILINPCLI LVDHGHFQYN CISLGLTVGA IAAVLSHKDL VASVLFCLSL NHKQMSAYFA    240
PAFFSHLLGK CLKHKNPVLE VSKLGLVVLG TFTIIWWPYL NSRDTVMEVL FRLAPFERGI    300
YEDYVANFWC TTSILIKWKR LFTTQSLKFV SLLATVLTFL PSMVQQIMAP SRKGFLYALV    360
NSSFSFYLFS FQVHEKSILL PLLPASLLAT ELRGPFELLM HYALFSMFPL LCRDKLIVPY    420
VALYALFFLL YFTPSGRKDA KIHNSTTLTC LSILLTFLYL CSLLLHILYL IIHPPKKYPF    480
LFEAMIMLLC FSHFILFVSY TNAQQWMLSR PYTLKDKEKK LN*                      540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03155Alg6_Alg85.0e-11643503470+
Gene Ontology
GO TermDescription
GO:0005789endoplasmic reticulum membrane
GO:0016758transferase activity, transferring hexosyl groups
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqNP_001145139.103950836506hypothetical protein LOC100278369 [Zea mays]
RefSeqNP_198662.1025208531ALG6, ALG8 glycosyltransferase family protein [Arabidopsis thaliana]
RefSeqXP_002280181.1015211515PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002305159.104752215491predicted protein [Populus trichocarpa]
RefSeqXP_002329281.104752111485predicted protein [Populus trichocarpa]
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5470EC-2.4.1.267Dol-P-Glc:Man9GlcNAc2-PP-Dol α-1,3-glucosyltransferase
Transmembrane Domains
StartEnd
143165
175192
199216
258280
327349
416435
448470
480502
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT559534274182900
FS33072725452580
DN6203322721424130
DT57125625612530
FC45742624852520
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_007_00849.3Aquca_007_00849.4Aquca_007_00849.2Aquca_007_00849.1
Arabidopsis lyrata494131
Arabidopsis thalianaAT5G38460.2AT5G38460.1
Brachypodium distachyonBradi1g63540.1
Brassica rapaBra028183
Capsella rubellaCarubv10004565m
Chlamydomonas reinhardtiiCre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572Cre16.g690150.t1.2.24.157Cre16.g690150.t1.2.206.572
Citrus clementinaCiclev10011466mCiclev10011636mCiclev10012149m
Citrus sinensisorange1.1g021456m
Cucumis sativusCucsa.031380.1
Eucalyptus grandisEucgr.F02485.1Eucgr.F02485.2.50.327Eucgr.F02485.2.50.327Eucgr.F02485.2.327.474Eucgr.F02485.2.327.474
Fragaria vescamrna11817.1-v1.0-hybrid
Glycine maxGlyma13g07560.1
Gossypium raimondiiGorai.006G229700.2Gorai.006G229700.1
Linum usitatissimumLus10017594Lus10033554
Malus domesticaMDP0000909996MDP0000278459MDP0000180745MDP0000308736
Manihot esculentacassava4.1_009619m
Mimulus guttatusmgv1a004432m
Oryza sativaLOC_Os07g07010.1
Panicum virgatumPavirv00049296mPavirv00013587mPavirv00013588m
Physcomitrella patensPp1s290_38V6.3Pp1s290_38V6.2Pp1s290_38V6.1
Phaseolus vulgarisPhvul.004G064500.1Phvul.002G243400.1Phvul.002G243400.2
Picea abiesMA_111087g0010
Populus trichocarpaPotri.017G114100.2Potri.004G100500.1Potri.017G114100.1
Prunus persicappa004184m
Ricinus communis30205.m001578
Setaria italicaSi036186mSi035197m
Selaginella moellendorffii114109
Sorghum bicolorSb01g036460.2.41.351Sb01g036460.2.41.351Sb01g036460.1Sb01g036460.2.352.477Sb01g036460.2.352.477
Thellungiella halophilaThhalv10017711mThhalv10027717m
Vitis viniferaGSVIVT01031043001
Volvox carteriVocar20001407m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny