y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_005809m
FamilyGH116
Protein PropertiesLength: 512 Molecular Weight: 57319.8 Isoelectric Point: 5.2281
ChromosomeChromosome/Scaffold: 02421 Start: 383446 End: 385687
DescriptionBeta-glucosidase, GBA2 type family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GH116944560
  GRFLYLEGVEYIMWCTYDVHFYASFALLDLFPKIELNIQRDFAKAVLSEDGRKVKFLAEGNVGIRKVRGAVPHDLGMHDPWNEMNAYNIHDTSKWKDLNS
  KFVLQVYRDFAATRDMSFGVDVWPAVRIAMEYMEQFDRDDDALIENDGFPDQTYDTWTVHGVSAYCGCLWLAALQAAAAMALQLGDNYFAELCKSKFVKA
  KSAFEAKLWNDSYFNYDSGSSSNSKSIQADQLAGQWYTASAGLPPLFDEVKIRSSLQKIFDFNVMKVRGGRMGAVNGMHPNGKVDETCMQSREIWSGVTY
  AVAATMILAGMEDQAFTTAEGIFLAGWSEEGYGYWFQTPEAWTTDGHFRSLIYMRPLAIWGMQ
Full Sequence
Protein Sequence     Length: 512     Download
MTGDVRDSHH QTKEIETMDV NVIEAPVSHT KGAVNHTSIP KYNVANVRSA DNDETSNAEC    60
PSKDESAVFQ EKGGLSHLKP SPLQEPWNDN DEVGRFLYLE GVEYIMWCTY DVHFYASFAL    120
LDLFPKIELN IQRDFAKAVL SEDGRKVKFL AEGNVGIRKV RGAVPHDLGM HDPWNEMNAY    180
NIHDTSKWKD LNSKFVLQVY RDFAATRDMS FGVDVWPAVR IAMEYMEQFD RDDDALIEND    240
GFPDQTYDTW TVHGVSAYCG CLWLAALQAA AAMALQLGDN YFAELCKSKF VKAKSAFEAK    300
LWNDSYFNYD SGSSSNSKSI QADQLAGQWY TASAGLPPLF DEVKIRSSLQ KIFDFNVMKV    360
RGGRMGAVNG MHPNGKVDET CMQSREIWSG VTYAVAATMI LAGMEDQAFT TAEGIFLAGW    420
SEEGYGYWFQ TPEAWTTDGH FRSLIYMRPL AIWGMQWALS LPKAILEAPK INIMDKLLLS    480
PSTRFALHET GVRKIATKAK CFGASVFHCA C*                                  540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG4354COG43545.0e-6390459391+
pfam04685DUF6089.0e-15194457367+
Gene Ontology
GO TermDescription
GO:0004348glucosylceramidase activity
GO:0006665sphingolipid metabolic process
GO:0016021integral to membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
DDBJBAB01359.1062511495937unnamed protein product [Arabidopsis thaliana]
EMBLCAN61187.106511357900hypothetical protein [Vitis vinifera]
RefSeqXP_002285674.106511471978PREDICTED: similar to catalytic [Vitis vinifera]
RefSeqXP_002303825.102511458966predicted protein [Populus trichocarpa]
RefSeqXP_002518119.1016511472968conserved hypothetical protein [Ricinus communis]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO7798602792365120
HO779860150882370
GT0515213331464780
GT0327923251464700
GT0459923371604960
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_017_00087.2Aquca_017_00087.1Aquca_034_00116.1
Arabidopsis lyrata331392479911473529327181
Arabidopsis thalianaAT1G33700.2AT1G33700.1AT5G49900.1AT3G24180.2AT3G24180.1
AT4G10060.1
Brachypodium distachyonBradi3g28580.1Bradi4g21277.1Bradi3g13487.1Bradi1g28847.1Bradi3g13520.1
Brassica rapaBra014964Bra028008Bra000598Bra028320Bra033199
Carica papayaevm.model.supercontig_59.121evm.model.supercontig_21.79evm.model.supercontig_113.12
Capsella rubellaCarubv10025826mCarubv10012912mCarubv10008221mCarubv10002637m
Citrus clementinaCiclev10004255mCiclev10000199mCiclev10018743mCiclev10018742m
Citrus sinensisorange1.1g039165morange1.1g002202morange1.1g038924m
Cucumis sativusCucsa.266300.2Cucsa.266300.1Cucsa.023010.1Cucsa.237200.1Cucsa.237200.2
Eucalyptus grandisEucgr.I02786.1Eucgr.H02851.2Eucgr.H02851.1Eucgr.H00075.1Eucgr.F02980.1
Eucgr.F02980.2
Fragaria vescamrna29905.1-v1.0-hybridmrna02278.1-v1.0-hybrid
Glycine maxGlyma10g33610.1Glyma20g33990.1Glyma07g40310.2
Gossypium raimondiiGorai.008G046700.1Gorai.011G160300.5Gorai.011G160300.4Gorai.011G160300.3Gorai.011G160300.2
Gorai.011G160300.1Gorai.013G133800.2Gorai.013G133800.1Gorai.006G221200.3Gorai.006G221200.2
Gorai.006G221200.1Gorai.008G046700.3Gorai.008G046700.2.531.722Gorai.008G046700.2.531.722Gorai.008G046700.2.724.851
Gorai.008G046700.2.724.851
Linum usitatissimumLus10000757Lus10003517Lus10002950Lus10023340Lus10038471
Lus10038469
Malus domesticaMDP0000175141MDP0000220028MDP0000128604
Manihot esculentacassava4.1_001108mcassava4.1_002224mcassava4.1_003299m
Medicago truncatulaMedtr1g072720.1Medtr1g072680.1
Mimulus guttatusmgv1a000876mmgv1a000873m
Oryza sativaLOC_Os10g33420.1LOC_Os11g13810.1LOC_Os08g01940.2LOC_Os08g01940.1LOC_Os07g26210.1
LOC_Os07g26210.2
Panicum virgatumPavirv00047844mPavirv00042892mPavirv00041095mPavirv00002207mPavirv00050055m
Pavirv00014420mPavirv00035631mPavirv00038108m
Physcomitrella patensPp1s134_55V6.1Pp1s40_202V6.1
Phaseolus vulgarisPhvul.007G134300.1Phvul.003G075400.1
Picea abiesMA_10430605g0020MA_10431145g0020MA_61180g0010MA_35878g0010MA_10426003g0020.110.198
MA_10426003g0020.110.198MA_165077g0010
Populus trichocarpaPotri.T163400.1Potri.019G072800.2Potri.019G072800.1Potri.004G227200.4Potri.004G227200.2
Potri.004G227200.1Potri.003G178000.4Potri.003G178000.3Potri.003G178000.2Potri.003G178000.1
Potri.003G003400.1Potri.003G003400.2Potri.019G072800.3Potri.004G227200.3Potri.003G003400.3
Prunus persicappa001012mppa000954m
Ricinus communis29685.m00048429757.m00075229904.m002967
Setaria italicaSi034088mSi026057mSi025923mSi029270mSi028945m
Si028854mSi013210mSi026013m
Selaginella moellendorffii16663492385
Sorghum bicolorSb01g019510.2Sb01g019510.1Sb05g007160.1Sb0073s002050.1Sb07g001140.1
Thellungiella halophilaThhalv10006714mThhalv10012588mThhalv10020003mThhalv10020001m
Vitis viniferaGSVIVT01036381001GSVIVT01023217001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)