y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_007176m
FamilyGT35
Protein PropertiesLength: 463 Molecular Weight: 51876.4 Isoelectric Point: 7.9569
ChromosomeChromosome/Scaffold: 12453 Start: 48 End: 4605
DescriptionGlycosyl transferase, family 35
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT351134620
  GEKTTAYTNHTVLPEALEKWSLDLMQNLLPRHVEIIEMIDEQLINTIVSEYGREDSDLLEKKLKEMRILENVDLPSTFANLIAKPKESSAAAISENSDEA
  GKLINEKDEVDSGDETESKGGPKSTGARKKEEVVAEPPPKMVRMANLCVVGGHAVNGVAAIHSEIVKDEVFNSFYKLWPNKFQNKTNGVTPRRWIRFCNP
  DLSKIITEWTGSEEWVLNTEKLAELRKFADNEDFQTQWRAAKKSNKMKVASLLKEKTGYSVSPDAMFDIQVKRIHEYKRQLLNILGIVYRYKKMKEMSAV
  ERKAKYVPRVCIFGGKAFATYVQAKRIVKFITDVGATVNHDPEIGDLLKV
Full Sequence
Protein Sequence     Length: 463     Download
MGNPWEIVRN DISYPVKFYG KVVSGSDGKK HWIGGEDIMA VAYDLPIPGY KTKSTINLRL    60
WSTKAPAEDL DLSAFNAGEQ TKAYEALANA EKLISNVPFC SASVSASAWS FLGEKTTAYT    120
NHTVLPEALE KWSLDLMQNL LPRHVEIIEM IDEQLINTIV SEYGREDSDL LEKKLKEMRI    180
LENVDLPSTF ANLIAKPKES SAAAISENSD EAGKLINEKD EVDSGDETES KGGPKSTGAR    240
KKEEVVAEPP PKMVRMANLC VVGGHAVNGV AAIHSEIVKD EVFNSFYKLW PNKFQNKTNG    300
VTPRRWIRFC NPDLSKIITE WTGSEEWVLN TEKLAELRKF ADNEDFQTQW RAAKKSNKMK    360
VASLLKEKTG YSVSPDAMFD IQVKRIHEYK RQLLNILGIV YRYKKMKEMS AVERKAKYVP    420
RVCIFGGKAF ATYVQAKRIV KFITDVGATV NHDPEIGDLL KV*                      480
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
TIGR02093P_ylase4.0e-452183251+
cd04300GT1_Glycogen_Phosphorylase8.0e-532183251+
pfam00343Phosphorylase3.0e-93234462229+
TIGR02093P_ylase2.0e-93233462230+
cd04300GT1_Glycogen_Phosphorylase8.0e-108245462218+
Gene Ontology
GO TermDescription
GO:0004645phosphorylase activity
GO:0005975carbohydrate metabolic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PRF/SEQDB01462230763UP10_LACSN Unknown protein 10 from 2D-PAGE
Swiss-ProtP2759801462230763PHSL_IPOBA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L; Flags: Precursor
Swiss-ProtP5353601462255811PHSL_VICFA RecName: Full=Alpha-1,4 glucan phosphorylase L isozyme, chloroplastic/amyloplastic; AltName: Full=Starch phosphorylase L; Flags: Precursor
RefSeqXP_002305367.101462210757predicted protein [Populus trichocarpa]
RefSeqXP_002526085.101462247785glycogen phosphorylase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1qm5_B0252462402607A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question
PDB1qm5_B0.00000004108155332378A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question
PDB1qm5_B0.001493167251A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question
PDB1qm5_A0252462402607A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question
PDB1qm5_A0.00000004108155332378A Chain A, Phosphorylase Recognition And Phosphorylysis Of Its Oligosaccharide Substrate: Answers To A Long Outstanding Question
Metabolic Pathways
Pathway NameReactionECProtein Name
starch degradation IRXN-1826EC-2.4.1.1phosphorylase
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
HO77830353714620
ES8175663041774620
CO1148272282384620
CO0873932282384620
ES8060482282384620
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_009_00755.3Aquca_009_00755.2Aquca_009_00755.1Aquca_002_00786.1Aquca_002_00786.2
Arabidopsis lyrata485074323006
Arabidopsis thalianaAT3G46970.1AT3G29320.1
Brachypodium distachyonBradi2g55120.1Bradi1g08070.1.569.972Bradi1g08070.1.569.972Bradi1g08070.1.163.525Bradi1g08070.1.163.525
Brassica rapaBra018180Bra025392Bra033098
Carica papayaevm.model.supercontig_27.5evm.model.supercontig_112.64.358.739evm.model.supercontig_112.64.358.739evm.model.supercontig_14.158evm.model.supercontig_112.64.117.357
evm.model.supercontig_112.64.117.357
Capsella rubellaCarubv10019408mCarubv10016634m
Chlamydomonas reinhardtiiCre12.g552200.t1.2Cre07.g336950.t1.1
Citrus clementinaCiclev10027815mCiclev10027813mCiclev10010975m.585.995Ciclev10010975m.585.995Ciclev10010975m.176.514
Ciclev10010975m.176.514
Citrus sinensisorange1.1g004485morange1.1g003202morange1.1g003197morange1.1g003196morange1.1g003188m
orange1.1g003186morange1.1g005595morange1.1g003693morange1.1g003742morange1.1g004697m
orange1.1g004696morange1.1g007597morange1.1g003875m.374.784orange1.1g003875m.374.784orange1.1g003079m.434.844
orange1.1g003079m.434.844orange1.1g003074m.434.844orange1.1g003074m.434.844orange1.1g003072m.434.844orange1.1g003072m.434.844
orange1.1g003055m.436.846orange1.1g003055m.436.846orange1.1g001879m.585.995orange1.1g001879m.585.995orange1.1g009651m
orange1.1g002111morange1.1g012447morange1.1g005402m.400.692orange1.1g005402m.400.692orange1.1g005402m.25.349
orange1.1g005402m.25.349orange1.1g003079m.25.349orange1.1g003079m.25.349orange1.1g003074m.25.349orange1.1g003074m.25.349
orange1.1g003072m.25.349orange1.1g003072m.25.349orange1.1g001879m.176.500orange1.1g001879m.176.500orange1.1g003055m.25.351
orange1.1g003055m.25.351orange1.1g026345m
Cucumis sativusCucsa.126920.10Cucsa.126920.1Cucsa.139040.4Cucsa.139040.3Cucsa.139040.2
Cucsa.139040.1Cucsa.284600.1Cucsa.273090.1
Eucalyptus grandisEucgr.B02278.2Eucgr.B02278.1Eucgr.B03166.3Eucgr.B03166.2Eucgr.J01374.1
Eucgr.B03166.1Eucgr.B03166.5Eucgr.B03166.4
Fragaria vescamrna29749.1-v1.0-hybridmrna07968.1-v1.0-hybridmrna04322.1-v1.0-hybrid.157.481mrna04322.1-v1.0-hybrid.157.481
Glycine maxGlyma13g30920.2Glyma13g30920.3Glyma08g45210.1Glyma18g07480.1Glyma20g03250.4.554.965
Glyma20g03250.4.554.965Glyma20g03250.3.562.973Glyma20g03250.3.562.973Glyma20g03250.2.562.973Glyma20g03250.2.562.973
Glyma13g06040.1Glyma19g03490.1Glyma20g03250.4.161.485Glyma20g03250.4.161.485Glyma20g03250.3.169.493
Glyma20g03250.3.169.493Glyma20g03250.2.169.493Glyma20g03250.2.169.493
Gossypium raimondiiGorai.009G166800.1Gorai.013G260900.2Gorai.013G260900.1Gorai.013G260900.3Gorai.006G011500.7.330.728
Gorai.006G011500.7.330.728Gorai.006G011500.4.514.912Gorai.006G011500.4.514.912Gorai.006G011500.3.580.978Gorai.006G011500.3.580.978
Gorai.006G011500.2.583.981Gorai.006G011500.2.583.981Gorai.006G011500.1.583.986Gorai.006G011500.1.583.986Gorai.013G092200.1
Gorai.013G092200.2Gorai.006G011500.6.177.501Gorai.006G011500.6.177.501Gorai.006G011500.5.180.504Gorai.006G011500.5.180.504
Gorai.006G011500.4.111.435Gorai.006G011500.4.111.435Gorai.006G011500.3.177.501Gorai.006G011500.3.177.501Gorai.006G011500.2.180.504
Gorai.006G011500.2.180.504Gorai.006G011500.1.180.504Gorai.006G011500.1.180.504Gorai.006G011500.6.580.815Gorai.006G011500.6.580.815
Gorai.006G011500.5.583.818Gorai.006G011500.5.583.818
Linum usitatissimumLus10036892Lus10042688Lus10037093Lus10029643Lus10029644
Malus domesticaMDP0000288190MDP0000123354MDP0000266061MDP0000129346.602.999MDP0000129346.602.999
MDP0000145828MDP0000128518MDP0000778598MDP0000259799MDP0000129346.170.509
MDP0000129346.170.509MDP0000211642
Manihot esculentacassava4.1_001626mcassava4.1_002082mcassava4.1_024481mcassava4.1_002466mcassava4.1_002614m.310.707
cassava4.1_002614m.310.707cassava4.1_001096mcassava4.1_025456mcassava4.1_004717m.211.560cassava4.1_004717m.211.560
cassava4.1_002614m.25.217cassava4.1_002614m.25.217cassava4.1_004717m.25.195cassava4.1_004717m.25.195cassava4.1_009211m
Medicago truncatulaMedtr2g014460.1Medtr6g014480.1Medtr4g082950.1.578.876Medtr4g082950.1.578.876Medtr4g082950.1.170.494
Medtr4g082950.1.170.494Medtr6g014480.2
Mimulus guttatusmgv1a000698mmgv1a001277mmgv1a000878mmgv1a002586mmgv1a002585m
Oryza sativaLOC_Os01g63270.1LOC_Os01g63270.2LOC_Os03g55090.1
Panicum virgatumPavirv00009874mPavirv00050649mPavirv00050650mPavirv00004990m.515.914Pavirv00004990m.515.914
Pavirv00034922m.529.918Pavirv00034922m.529.918Pavirv00034922m.119.465Pavirv00034922m.119.465Pavirv00004990m.97.438
Pavirv00004990m.97.438
Physcomitrella patensPp1s30_182V6.1Pp1s180_124V6.1Pp1s86_213V6.1Pp1s195_41V6.1Pp1s53_212V6.1.566.981
Pp1s53_212V6.1.566.981Pp1s53_212V6.1.179.499Pp1s53_212V6.1.179.499
Phaseolus vulgarisPhvul.006G182300.1Phvul.006G064100.1Phvul.002G168400.1.570.971Phvul.002G168400.1.570.971Phvul.004G034400.1.582.980
Phvul.004G034400.1.582.980Phvul.002G168400.1.169.519Phvul.002G168400.1.169.519Phvul.004G034400.1.180.504Phvul.004G034400.1.180.504
Picea abiesMA_10437129g0010MA_14581g0010MA_10428980g0010
Populus trichocarpaPotri.004G048600.1Potri.004G048600.2Potri.009G041800.1Potri.009G041800.3Potri.010G160200.2
Potri.009G041800.4Potri.009G041800.2.126.655Potri.009G041800.2.126.655Potri.004G123600.5Potri.010G160200.5
Potri.010G160200.1Potri.010G160200.7Potri.010G160200.4Potri.010G160200.3Potri.004G123600.4.176.534
Potri.004G123600.4.176.534Potri.004G123600.3.176.534Potri.004G123600.3.176.534Potri.004G123600.2.176.534Potri.004G123600.2.176.534
Potri.004G123600.1.176.533Potri.004G123600.1.176.533Potri.010G160200.6Potri.009G041800.2.660.825Potri.009G041800.2.660.825
Prunus persicappa000587mppa001354mppa000958mppa000827m.586.983ppa000827m.586.983
ppa000827m.171.506ppa000827m.171.506
Ricinus communis29751.m00179630190.m011310.461.94330190.m011310.461.94330174.m00913629630.m000793
30190.m011310.264.44430190.m011310.264.444
Setaria italicaSi000306mSi034019m
Selaginella moellendorffii148158164611184206
Sorghum bicolorSb03g040060.1Sb01g007560.2.550.949Sb01g007560.2.550.949Sb01g007560.1.580.979Sb01g007560.1.580.979
Sb01g007560.2.140.492Sb01g007560.2.140.492Sb01g007560.1.170.522Sb01g007560.1.170.522
Thellungiella halophilaThhalv10010122mThhalv10003599m
Vitis viniferaGSVIVT01021111001GSVIVT01024804001GSVIVT01012194001GSVIVT01011504001.577.977GSVIVT01011504001.577.977
GSVIVT01011504001.177.501GSVIVT01011504001.177.501
Volvox carteriVocar20006426mVocar20001423m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)