y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_008785m
FamilyGT4
Protein PropertiesLength: 409 Molecular Weight: 46060.2 Isoelectric Point: 8.1351
ChromosomeChromosome/Scaffold: 06749 Start: 1119 End: 4810
DescriptionUDP-Glycosyltransferase superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT42123757.4e-40
  FLSINRFERKKNIELAISAFAMLHTLDKHAFQNHNLSDATLTIAGGYDKRLRENVEYLEELESLAEREGVSHRVKFITSCSTAERNALLSQCLCVIYTPK
  DEHFGIVPLEAMAAHKPVIACNSGGPVETVKDEVTGFLCDSTPKSFSLAMGKLLQDPEMAKKMG
Full Sequence
Protein Sequence     Length: 409     Download
MERKGNSKLN IAIIHPDLGI GGAERLIVDA AVELASHGHN VRIFTAHHDK NRCFEETVSG    60
SFPVTVYGSF LPRHIFYRLH AVCAYLRCIF VALCVLFLWR SFDVILADQV SVVIPLLKVK    120
KSTKVVFYCH FPDLLLAQHT TVLRRLYRKP IDFVEEITTG KADLILVNSK FTAYTFANTF    180
KHLHSRGIRP AVLYPAVNVD QFDEFHSYKL NFLSINRFER KKNIELAISA FAMLHTLDKH    240
AFQNHNLSDA TLTIAGGYDK RLRENVEYLE ELESLAEREG VSHRVKFITS CSTAERNALL    300
SQCLCVIYTP KDEHFGIVPL EAMAAHKPVI ACNSGGPVET VKDEVTGFLC DSTPKSFSLA    360
MGKLLQDPEM AKKMGEQARQ HVTESFSTKI FGQHLNQYLI NISSSKED*                420
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
COG0438RfaG2.0e-368406407+
cd03811GT1_WabH_like2.0e-4010387392+
cd03798GT1_wlbH_like1.0e-409398415+
cd03801GT1_YqgM_like2.0e-5010387397+
cd03805GT1_ALG2_like09395400+
Gene Ontology
GO TermDescription
GO:0009058biosynthetic process
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankACU21459.1014081407unknown [Glycine max]
EMBLCBI20181.1014081396unnamed protein product [Vitis vinifera]
RefSeqXP_002285480.1014081408PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002317454.1014081413predicted protein [Populus trichocarpa]
RefSeqXP_002525620.1014081408alpha-1,3-mannosyltransferase, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB2f9f_A2e-1820437318168A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_B0.0000000006275381278385A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4v_A0.0000000006275381278385A Chain A, Crystal Structure Of The Putative Mannosyl Transferase (Wbaz-1)from Archaeoglobus Fulgidus, Northeast Structural Genomics Target Gr29a
PDB3c4q_B0.0000000006275381278385A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
PDB3c4q_A0.0000000006275381278385A Chain A, Structure Of The Retaining Glycosyltransferase Msha : The First Step In Mycothiol Biosynthesis. Organism : Corynebacterium Glutamicum- Complex With Udp
Metabolic Pathways
Pathway NameReactionECProtein Name
dolichyl-diphosphooligosaccharide biosynthesisRXN-5462EC-2.4.1.132GDP-Man:Man1GlcNAc2-PP-Dol α-1,3-mannosyltransferase
dolichyl-diphosphooligosaccharide biosynthesisRXN-5463EC-2.4.1.257GDP-Man:Man2GlcNAc2-PP-Dol α-1,6-mannosyltransferase
Transmembrane Domains
StartEnd
7799
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
CK27432531353170
EL44718731613160
EL45605232023210
GO87472533783410
DY96374631413140
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_021_00182.1Aquca_021_00182.2Aquca_021_00182.3
Arabidopsis lyrata477043
Arabidopsis thalianaAT1G78800.1
Brachypodium distachyonBradi5g19840.1
Brassica rapaBra035064
Carica papayaevm.model.supercontig_77.17
Capsella rubellaCarubv10022022m
Chlamydomonas reinhardtiig1920.t1
Citrus clementinaCiclev10022599mCiclev10020399m
Citrus sinensisorange1.1g036860m
Cucumis sativusCucsa.220170.2Cucsa.273740.2Cucsa.273740.1Cucsa.220170.1
Eucalyptus grandisEucgr.F01245.1
Fragaria vescamrna27271.1-v1.0-hybrid
Glycine maxGlyma12g35950.2Glyma12g35950.1Glyma13g34430.1Glyma13g34430.2
Gossypium raimondiiGorai.002G054000.2Gorai.002G054000.1
Linum usitatissimumLus10037008Lus10015797
Malus domesticaMDP0000319369MDP0000185482
Medicago truncatulaMedtr1g104880.1
Mimulus guttatusmgv1a007424m
Oryza sativaLOC_Os04g49960.1
Panicum virgatumPavirv00018845mPavirv00056995mPavirv00050038mPavirv00004378m
Physcomitrella patensPp1s246_77V6.1
Phaseolus vulgarisPhvul.005G081600.1
Picea abiesMA_499839g0010
Populus trichocarpaPotri.011G109000.1
Prunus persicappa006490mppa006502m
Ricinus communis29681.m001322
Setaria italicaSi017356mSi013830mSi010219m
Selaginella moellendorffii419620
Sorghum bicolorSb06g026860.1
Thellungiella halophilaThhalv10019736mThhalv10007837m
Vitis viniferaGSVIVT01014186001
Volvox carteriVocar20014584m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny