y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_010734m
FamilyGT64
Protein PropertiesLength: 353 Molecular Weight: 39875.6 Isoelectric Point: 9.5216
ChromosomeChromosome/Scaffold: 05859 Start: 13027 End: 14085
DescriptionNucleotide-diphospho-sugar transferases superfamily protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT64593300
  ITVLINGYSESRIPLLQTIAATYSASPLVSSVLVLWGNPSTSSQTLAHLAHNLSISSFGQATISLVRQRSSSLNDRFLPRSSIETQAVLICDDDVEVDHK
  SFHFAFRIWRSNPDNLIGFFVRSHDLDLSSRKWIYTVHPDKYSIVLTKFMILKSQNLFEYSCKGGSNMSEMRKTVDRMQNCEDILMNFVVADQANKGPIL
  VGAERVRDWGDARNDENDDGRLESENGARKSVKAVGLSSRRGEHRKRRGECIREFHKLLGRMPLRYSYGKVV
Full Sequence
Protein Sequence     Length: 353     Download
MWKKSRLKFH TITSMVNVLL YVCLLLPLPL GAFSFHTLPS DPCDPANEPG RRNLRADQIT    60
VLINGYSESR IPLLQTIAAT YSASPLVSSV LVLWGNPSTS SQTLAHLAHN LSISSFGQAT    120
ISLVRQRSSS LNDRFLPRSS IETQAVLICD DDVEVDHKSF HFAFRIWRSN PDNLIGFFVR    180
SHDLDLSSRK WIYTVHPDKY SIVLTKFMIL KSQNLFEYSC KGGSNMSEMR KTVDRMQNCE    240
DILMNFVVAD QANKGPILVG AERVRDWGDA RNDENDDGRL ESENGARKSV KAVGLSSRRG    300
EHRKRRGECI REFHKLLGRM PLRYSYGKVV NSVGEQGLCM KRGKLVFCDQ YQ*           360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam09258Glyco_transf_646.0e-8559330273+
Gene Ontology
GO TermDescription
GO:0016758transferase activity, transferring hexosyl groups
GO:0031227intrinsic to endoplasmic reticulum membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
EMBLCAN68561.103035116327hypothetical protein [Vitis vinifera]
RefSeqNP_565236.104135030328glycosyltransferase family protein 47 [Arabidopsis thaliana]
RefSeqXP_002280907.103035116327PREDICTED: hypothetical protein [Vitis vinifera]
RefSeqXP_002330776.10213526333predicted protein [Populus trichocarpa]
RefSeqXP_002523753.103735235349transferase, transferring glycosyl groups, putative [Ricinus communis]
Annotations - PDB Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
PDB1on8_B2e-185732528275X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1on8_A2e-185732528275X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1on6_B2e-185732528275X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1on6_A2e-185732528275X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
PDB1omz_B2e-185732528275X Chain X, Crystal Structure Of The Full-Length Autotransporter Esta From Pseudomonas Aeruginosa
Transmembrane Domains
StartEnd
1335
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
ES810103257943500
EG662500217372530
EL480538270813500
FC882063244332720
DY265021295323180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_018_00173.1Aquca_013_00497.1Aquca_004_00315.3Aquca_004_00315.1Aquca_004_00315.4
Aquca_004_00315.2Aquca_004_00315.5Aquca_009_01030.2Aquca_009_01030.1Aquca_019_00086.1
Aquca_009_01029.1
Arabidopsis lyrata340192908336
Arabidopsis thalianaAT1G80290.2AT1G80290.1AT3G55830.1AT5G04500.1
Brachypodium distachyonBradi3g40395.1Bradi1g34550.1Bradi1g12290.1Bradi1g34550.2Bradi2g18300.1
Brassica rapaBra008483Bra007194Bra009448Bra028787
Carica papayaevm.model.supercontig_488.3evm.model.supercontig_19.204evm.model.supercontig_4.178evm.model.supercontig_128.65
Capsella rubellaCarubv10016140mCarubv10017597mCarubv10003280m
Chlamydomonas reinhardtiiCre12.g508700.t1.2
Citrus clementinaCiclev10010680mCiclev10032067mCiclev10030719m
Citrus sinensisorange1.1g020041morange1.1g045656m
Cucumis sativusCucsa.311230.1Cucsa.368680.1Cucsa.308870.2Cucsa.308870.1
Eucalyptus grandisEucgr.C04240.1Eucgr.G03038.1Eucgr.K00135.1Eucgr.G02723.2Eucgr.G02723.1
Eucgr.K00135.2
Fragaria vescamrna08756.1-v1.0-hybridmrna20928.1-v1.0-hybridmrna09156.1-v1.0-hybridmrna21215.1-v1.0-hybrid
Glycine maxGlyma15g03130.1Glyma14g19550.1Glyma14g06670.1Glyma02g42230.1Glyma14g06670.2
Glyma09g27660.1Glyma16g32650.1Glyma09g27660.2Glyma10g34440.2Glyma20g33120.3
Glyma20g33120.2Glyma14g06670.3
Gossypium raimondiiGorai.008G132700.3Gorai.008G132700.2Gorai.008G132700.1Gorai.012G075900.1Gorai.009G307300.1
Gorai.012G075900.2
Linum usitatissimumLus10020174Lus10040216Lus10028274Lus10031680Lus10037920
Lus10038646Lus10027392
Malus domesticaMDP0000318911MDP0000177948MDP0000292999MDP0000138795MDP0000212600
MDP0000169420
Manihot esculentacassava4.1_011626mcassava4.1_011602mcassava4.1_011301mcassava4.1_013504mcassava4.1_010773m
cassava4.1_002721mcassava4.1_002024mcassava4.1_012021m
Medicago truncatulaMedtr1g009180.1Medtr5g082110.1
Mimulus guttatusmgv1a026874mmgv1a009961mmgv1a009124mmgv1a023379mmgv1a024929m
Oryza sativaLOC_Os06g49150.1LOC_Os03g48010.1LOC_Os05g46260.1
Panicum virgatumPavirv00045941mPavirv00020436mPavirv00023272mPavirv00018756mPavirv00050841m
Pavirv00045066mPavirv00036974mPavirv00061476m
Physcomitrella patensPp1s242_74V6.1Pp1s87_187V6.1Pp1s242_81V6.1Pp1s72_263V6.1Pp1s117_57V6.1
Phaseolus vulgarisPhvul.002G252600.1Phvul.008G225700.1Phvul.004G124500.1Phvul.007G144400.1
Picea abiesMA_277070g0010MA_140607g0010MA_30471g0010MA_948289g0010MA_8306453g0010
MA_10432291g0040
Populus trichocarpaPotri.006G278400.1Potri.010G191700.7Potri.010G191700.1Potri.008G065800.1Potri.010G191700.2
Potri.010G191700.5Potri.008G028900.2Potri.008G028900.1Potri.010G232700.3Potri.010G232700.2
Potri.010G232700.1Potri.010G191700.4Potri.010G191700.3Potri.010G191700.8Potri.010G191700.6
Prunus persicappa008992mppa008488mppa007532mppa002869m
Ricinus communis29589.m00129129669.m00081027916.m00015930147.m014149
Setaria italicaSi014019mSi006792mSi034429mSi021307m
Selaginella moellendorffii13310340321881258420395139351
Sorghum bicolorSb07g027170.1Sb10g029290.1Sb01g011790.1Sb09g026940.1
Thellungiella halophilaThhalv10000547mThhalv10010522mThhalv10012710m
Vitis viniferaGSVIVT01032860001GSVIVT01034672001
Volvox carteriVocar20000857m
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)