y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_011268m
FamilyGT47
Protein PropertiesLength: 340 Molecular Weight: 39090.1 Isoelectric Point: 8.8098
ChromosomeChromosome/Scaffold: 00784 Start: 63166 End: 66772
DescriptionExostosin family protein
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT47872155.4e-24
  LKIYIYEEYEIDGLKELLRGREGKISPDACLKGQWGTQVKIHRLFLKSRFRTRKKEEADLFFVPAYVKCVRMMGGLNDKEINQTYVKVLSQMPYFRRSGG
  RDHVFVFPSGAGAHLFRSWATYINRSIIL
Full Sequence
Protein Sequence     Length: 340     Download
MGSLNNRAKI FTAHHQAPPC TRTHQIGAIL LVAATFFLTR LFDESFPACI PSSFDHHITP    60
QSQSLVHVTD GGSLSWPQRG YGTYLSLKIY IYEEYEIDGL KELLRGREGK ISPDACLKGQ    120
WGTQVKIHRL FLKSRFRTRK KEEADLFFVP AYVKCVRMMG GLNDKEINQT YVKVLSQMPY    180
FRRSGGRDHV FVFPSGAGAH LFRSWATYIN RSIILTPEEC VPVILSDQVE LPFQNVIDYT    240
HVSIKWPSTR IGPELLDYLE AIPDEDVERM IARGRLIRCL WVYAPESELC SAMQGLMWEL    300
QRKVRQFHQS AETFWLHNRT IVNRNLVEFS SWKPPMPLP*                          360
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
pfam03016Exostosin3.0e-722026243+
pfam03016Exostosin1.0e-1587213127+
Gene Ontology
GO TermDescription
GO:0016020membrane
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
GenBankABK93189.1012181218unknown [Populus trichocarpa]
RefSeqXP_002300942.1012181218predicted protein [Populus trichocarpa]
RefSeqXP_002300942.10219339340460predicted protein [Populus trichocarpa]
RefSeqXP_002307477.1012181218predicted protein [Populus trichocarpa]
RefSeqXP_002307477.10219339340460predicted protein [Populus trichocarpa]
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
JG00616021912180
DT49344022012180
GW87937819711960
CF23134922012180
DB892644192272180
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_014_00344.3Aquca_014_00344.1Aquca_014_00344.2
Arabidopsis lyrata472383
Arabidopsis thalianaAT1G21480.2AT1G21480.1
Brachypodium distachyonBradi5g20997.1
Brassica rapaBra016420Bra017918
Carica papayaevm.model.supercontig_49.73
Capsella rubellaCarubv10009077m
Citrus clementinaCiclev10001673mCiclev10002072mCiclev10001104mCiclev10001922m
Cucumis sativusCucsa.077120.2Cucsa.077120.1
Eucalyptus grandisEucgr.E02380.2Eucgr.E02380.1
Fragaria vescamrna00939.1-v1.0-hybrid
Glycine maxGlyma14g38290.1
Gossypium raimondiiGorai.005G082700.1Gorai.005G082700.6Gorai.005G082700.3Gorai.005G082700.2Gorai.005G082700.4
Gorai.005G082700.5
Linum usitatissimumLus10028632Lus10018930
Malus domesticaMDP0000251576MDP0000259719
Manihot esculentacassava4.1_012629m
Mimulus guttatusmgv1a006022m
Panicum virgatumPavirv00023264mPavirv00031056m
Physcomitrella patensPp1s48_252V6.1
Phaseolus vulgarisPhvul.001G063800.1
Populus trichocarpaPotri.002G072300.1Potri.005G187400.3Potri.005G187400.2Potri.005G187400.1
Prunus persicappa005428m
Ricinus communis27985.m000889
Setaria italicaSi002210mSi002276mSi001530m
Selaginella moellendorffii104774
Sorghum bicolorSb03g040220.1
Thellungiella halophilaThhalv10007584m
Vitis viniferaGSVIVT01010019001
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny