y
Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_015974m |
Family | AA2 |
Protein Properties | Length: 217 Molecular Weight: 22781.8 Isoelectric Point: 7.3426 |
Chromosome | Chromosome/Scaffold: 00823 Start: 68428 End: 69369 |
Description | peroxidase 2 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
AA2 | 54 | 196 | 7.28675e-44 |
ALQSDPRIGASLIRLHFHDCFVNGCDASLLLDNSSTILSEKFAAPNVNSARGFDVVDNIKTAVENSCPGVVSCADILALAAEASVSLSGGQSWSVLLGRR DSLTANQAGANTSIPSPFEGLNNITSKFSAVGLNTNDLVALSG |
Full Sequence |
---|
Protein Sequence Length: 217 Download |
MRSSKTTSAS SMVLPIVLAA LLLVHKSNAQ LSSTFYATTC SNVSAIVTSV VQQALQSDPR 60 IGASLIRLHF HDCFVNGCDA SLLLDNSSTI LSEKFAAPNV NSARGFDVVD NIKTAVENSC 120 PGVVSCADIL ALAAEASVSL SGGQSWSVLL GRRDSLTANQ AGANTSIPSP FEGLNNITSK 180 FSAVGLNTND LVALSGDSRE KTWFKSLRKF YPEMGF* 240 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
PLN02879 | PLN02879 | 0.008 | 105 | 196 | 92 | + L-ascorbate peroxidase | ||
cd00314 | plant_peroxidase_like | 9.0e-18 | 47 | 199 | 165 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
PLN03030 | PLN03030 | 2.0e-43 | 35 | 196 | 162 | + cationic peroxidase; Provisional | ||
pfam00141 | peroxidase | 2.0e-56 | 47 | 196 | 150 | + Peroxidase. | ||
cd00693 | secretory_peroxidase | 4.0e-83 | 30 | 196 | 167 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. |
Gene Ontology | |
---|---|
GO Term | Description |
GO:0004601 | peroxidase activity |
GO:0006979 | response to oxidative stress |
GO:0020037 | heme binding |
GO:0055114 | oxidation-reduction process |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | AAP42504.1 | 0 | 11 | 196 | 5 | 191 | anionic peroxidase swpa5 [Ipomoea batatas] |
DDBJ | BAF33316.1 | 0 | 8 | 196 | 4 | 191 | peroxidase [Populus alba] |
Swiss-Prot | Q9LEH3 | 0 | 11 | 214 | 5 | 207 | PER15_IPOBA RecName: Full=Peroxidase 15; Short=Prx15; AltName: Full=Anionic peroxidase; Flags: Precursor |
RefSeq | XP_002322726.1 | 0 | 22 | 196 | 1 | 174 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002530724.1 | 0 | 3 | 196 | 5 | 197 | Peroxidase 53 precursor, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 1qo4_A | 0 | 30 | 196 | 2 | 168 | B Chain B, Reassembly And Co-Crystallization Of A Family 9 Processive Endoglucanase From Separately Expressed Gh9 And Cbm3c Modules |
PDB | 1pa2_A | 0 | 30 | 196 | 2 | 168 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
PDB | 4a5g_B | 0 | 31 | 196 | 4 | 169 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 4a5g_A | 0 | 31 | 196 | 4 | 169 | A Chain A, Raphanus Sativus Anionic Peroxidase. |
PDB | 1fhf_C | 0 | 30 | 210 | 1 | 186 | A Chain A, The Structure Of Soybean Peroxidase |
Metabolic Pathways | |||
---|---|---|---|
Pathway Name | Reaction | EC | Protein Name |
betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
Signal Peptide | ||||
---|---|---|---|---|
Cleavage Site | ||||
29 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
DB920586 | 172 | 1 | 172 | 0 |
AJ776984 | 171 | 26 | 196 | 0 |
DT506706 | 171 | 26 | 196 | 0 |
DV126427 | 172 | 25 | 196 | 0 |
DV139132 | 172 | 25 | 196 | 0 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|
![]() |