| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_016069m |
| Family | GH16 |
| Protein Properties | Length: 214 Molecular Weight: 24099.8 Isoelectric Point: 4.7144 |
| Chromosome | Chromosome/Scaffold: 04882 Start: 213137 End: 214462 |
| Description | xyloglucan endotransglucosylase/hydrolase 4 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH16 | 42 | 174 | 4.5e-25 |
| GGARWRSTTRFLYGTFSSLIQCPQGNTSGLNFNIYLSSLEGDKSQDEIDFEFLGKDKTIVQTNYFTTGTGNREQIHDLGFDCSDGFHEYVIKWSPNSIEW LIDGKVVRKEERKDGVTFPEKPMFLYASIWDAS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 214 Download |
| MADPTLHHET HPIKQIAIDY TPEACTHCPV SNSITLTYDH RGGARWRSTT RFLYGTFSSL 60 IQCPQGNTSG LNFNIYLSSL EGDKSQDEID FEFLGKDKTI VQTNYFTTGT GNREQIHDLG 120 FDCSDGFHEY VIKWSPNSIE WLIDGKVVRK EERKDGVTFP EKPMFLYASI WDASCIDEGR 180 WSGTYVGCDE PYVCLYKDIH VPLGTAVECS SES* 240 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd02183 | GH16_fungal_CRH1_transglycosylase | 5.0e-26 | 31 | 201 | 186 | + glycosylphosphatidylinositol-glucanosyltransferase. Group of fungal GH16 members related to Saccharomyces cerevisiae Crh1p. Chr1p and Crh2p are transglycosylases that are required for the linkage of chitin to beta(1-3)glucose branches of beta(1-6)glucan, an important step in the assembly of new cell wall. Both have been shown to be glycosylphosphatidylinositol (GPI)-anchored. A third homologous protein, Crr1p, functions in the formation of the spore wall. They belongs to the family 16 of glycosyl hydrolases that includes lichenase, xyloglucan endotransglycosylase (XET), beta-agarase, kappa-carrageenase, endo-beta-1,3-glucanase, endo-beta-1,3-1,4-glucanase, and endo-beta-galactosidase, all of which have a conserved jelly roll fold with a deep active site channel harboring the catalytic residues. | ||
| PLN03161 | PLN03161 | 1.0e-26 | 32 | 173 | 148 | + Probable xyloglucan endotransglucosylase/hydrolase protein; Provisional | ||
| cd02175 | GH16_lichenase | 3.0e-35 | 43 | 185 | 145 | + lichenase, member of glycosyl hydrolase family 16. Lichenase, also known as 1,3-1,4-beta-glucanase, is a member of glycosyl hydrolase family 16, that specifically cleaves 1,4-beta-D-glucosidic bonds in mixed-linked beta glucans that also contain 1,3-beta-D-glucosidic linkages. Natural substrates of beta-glucanase are beta-glucans from grain endosperm cell walls or lichenan from the Islandic moss, Cetraria islandica. This protein is found not only in bacteria but also in anaerobic fungi. This domain includes two seven-stranded antiparallel beta-sheets that are adjacent to one another forming a compact, jellyroll beta-sandwich structure. | ||
| cd02176 | GH16_XET | 3.0e-42 | 32 | 174 | 149 | + Xyloglucan endotransglycosylase, member of glycosyl hydrolase family 16. Xyloglucan endotransglycosylases (XETs) cleave and religate xyloglucan polymers in plant cell walls via a transglycosylation mechanism. Xyloglucan is a soluble hemicellulose with a backbone of beta-1,4-linked glucose units, partially substituted with alpha-1,6-linked xylopyranose branches. It binds noncovalently to cellulose, cross-linking the adjacent cellulose microfibrils, giving it a key structural role as a matrix polymer. Therefore, XET plays an important role in all plant processes that require cell wall remodeling. | ||
| pfam00722 | Glyco_hydro_16 | 1.0e-46 | 31 | 174 | 145 | + Glycosyl hydrolases family 16. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004553 | hydrolase activity, hydrolyzing O-glycosyl compounds |
| GO:0005975 | carbohydrate metabolic process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | EAY88289.1 | 0 | 10 | 208 | 25 | 224 | hypothetical protein OsI_09745 [Oryza sativa Indica Group] |
| RefSeq | NP_001048767.1 | 0 | 10 | 208 | 25 | 224 | Os03g0117300 [Oryza sativa (japonica cultivar-group)] |
| RefSeq | NP_001150346.1 | 0 | 3 | 202 | 11 | 213 | xyloglucan endotransglucosylase/hydrolase protein 5 [Zea mays] |
| RefSeq | XP_002273975.1 | 0 | 1 | 208 | 1 | 208 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002301319.1 | 0 | 1 | 213 | 1 | 213 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2uwb_B | 1e-25 | 33 | 211 | 39 | 221 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2uwb_A | 1e-25 | 33 | 211 | 39 | 221 | A Chain A, Crystal Structure Of The Nasturtium Seedling Mutant Xyloglucanase Isoform Nxg1-Delta-Yniig |
| PDB | 2vh9_B | 1e-25 | 33 | 211 | 62 | 244 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
| PDB | 2vh9_A | 1e-25 | 33 | 211 | 62 | 244 | A Chain A, Crystal Structure Of Nxg1-Deltayniig In Complex With Xllg, A Xyloglucan Derived Oligosaccharide |
| PDB | 3d6e_B | 1e-24 | 87 | 193 | 91 | 191 | A Chain A, Crystal Structure Of The Engineered 1,3-1,4-Beta-Glucanase Protein From Bacillus Licheniformis |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| JG010818 | 205 | 10 | 214 | 0 |
| ES809470 | 214 | 1 | 214 | 0 |
| ES823691 | 214 | 1 | 214 | 0 |
| DW487295 | 213 | 2 | 214 | 0 |
| JK801697 | 214 | 1 | 214 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |