| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_018585m |
| Family | GT1 |
| Protein Properties | Length: 145 Molecular Weight: 15981.5 Isoelectric Point: 5.285 |
| Chromosome | Chromosome/Scaffold: 02817 Start: 57618 End: 58212 |
| Description | UDP-Glycosyltransferase superfamily protein |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
 | |||
| Family | Start | End | Evalue |
| GT1 | 13 | 119 | 3.2e-33 |
| GKVIGWAPQVAVLAHPAIGGFVSHCGWNSVLESLWFGVPIATWPMYAEQQFNAFEMVVELGLGVEIDMGYRKESGKIVNSDKIERAIRNLMENSDEKRKK VKEMREK | |||
| Full Sequence |
|---|
| Protein Sequence Length: 145 Download |
| MPEGFLERTV AVGKVIGWAP QVAVLAHPAI GGFVSHCGWN SVLESLWFGV PIATWPMYAE 60 QQFNAFEMVV ELGLGVEIDM GYRKESGKIV NSDKIERAIR NLMENSDEKR KKVKEMREKS 120 KMALIDGGSS FISLGDFIKD AMEG* |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
 | ||||||||
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| PLN02534 | PLN02534 | 3.0e-30 | 3 | 143 | 153 | + UDP-glycosyltransferase | ||
| PLN00164 | PLN00164 | 9.0e-46 | 1 | 134 | 139 | + glucosyltransferase; Provisional | ||
| PLN02207 | PLN02207 | 4.0e-50 | 1 | 142 | 143 | + UDP-glycosyltransferase | ||
| PLN02167 | PLN02167 | 1.0e-64 | 1 | 144 | 144 | + UDP-glycosyltransferase family protein | ||
| PLN02554 | PLN02554 | 2.0e-65 | 1 | 143 | 147 | + UDP-glycosyltransferase family protein | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0008152 | metabolic process |
| GO:0016758 | transferase activity, transferring hexosyl groups |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | ACZ44836.1 | 0 | 1 | 138 | 331 | 468 | glycosyltransferase [Pyrus communis] |
| Swiss-Prot | Q40284 | 0 | 1 | 143 | 307 | 449 | UFOG1_MANES RecName: Full=Anthocyanidin 3-O-glucosyltransferase 1; AltName: Full=Flavonol 3-O-glucosyltransferase 1; AltName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 1 |
| Swiss-Prot | Q40285 | 0 | 1 | 144 | 203 | 346 | UFOG2_MANES RecName: Full=Anthocyanidin 3-O-glucosyltransferase 2; AltName: Full=Flavonol 3-O-glucosyltransferase 2; AltName: Full=UDP-glucose flavonoid 3-O-glucosyltransferase 2 |
| RefSeq | XP_002520574.1 | 0 | 1 | 144 | 324 | 467 | UDP-glucosyltransferase, putative [Ricinus communis] |
| RefSeq | XP_002520576.1 | 0 | 1 | 144 | 324 | 467 | UDP-glucosyltransferase, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2acw_B | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acw_A | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 Complexed With Udp-Glucose |
| PDB | 2acv_B | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2acv_A | 0 | 1 | 140 | 320 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| PDB | 2vg8_A | 1e-29 | 1 | 134 | 328 | 460 | A Chain A, Crystal Structure Of Medicago Truncatula Ugt71g1 |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| anthocyanin biosynthesis (delphinidin 3-O-glucoside) | RXN-7815 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | PELUDP-RXN | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| anthocyanin biosynthesis (pelargonidin 3-O-glucoside, cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| superpathway of anthocyanin biosynthesis (from cyanidin and cyanidin 3-O-glucoside) | RXN1F-775 | EC-2.4.1.115 | anthocyanidin 3-O-glucosyltransferase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
 | ||||
| Hit | Length | Start | End | EValue |
| DV458724 | 145 | 1 | 145 | 0 |
| CX296211 | 148 | 1 | 144 | 0 |
| EY696422 | 148 | 1 | 144 | 0 |
| EY660649 | 147 | 1 | 143 | 0 |
| CN185680 | 148 | 1 | 144 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
