Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_019505m |
Family | CBM43 |
Protein Properties | Length: 118 Molecular Weight: 12571.1 Isoelectric Point: 4.5725 |
Chromosome | Chromosome/Scaffold: 09260 Start: 175121 End: 176277 |
Description | plasmodesmata callose-binding protein 5 |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 30 | 113 | 1.5e-31 |
WCVAKNNADDQALQAAIDWACGPGGADCGSIQQGGPCYDPNDIQKTASWCFNDYYLKHGLTDDACSFSNTAALISLNPSHDNCK |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
MSGYLLLLLV AFSLPLSLRG QNGLAPRDLW CVAKNNADDQ ALQAAIDWAC GPGGADCGSI 60 QQGGPCYDPN DIQKTASWCF NDYYLKHGLT DDACSFSNTA ALISLNPSHD NCKFPSR* 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-17 | 29 | 100 | 78 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 9.0e-33 | 29 | 114 | 86 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ABK92983.1 | 0 | 15 | 109 | 21 | 115 | unknown [Populus trichocarpa] |
RefSeq | XP_002279275.1 | 0 | 13 | 116 | 19 | 122 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002326029.1 | 0 | 5 | 116 | 11 | 122 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002327206.1 | 0 | 28 | 116 | 1 | 89 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002525141.1 | 0 | 21 | 116 | 23 | 119 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 4e-17 | 30 | 116 | 13 | 98 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |