Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_021354m |
Family | CBM43 |
Protein Properties | Length: 118 Molecular Weight: 13362.5 Isoelectric Point: 6.7639 |
Chromosome | Chromosome/Scaffold: 08508 Start: 1401 End: 1901 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 42 | 118 | 6.3e-27 |
WCVVNPSTPHDELLANLDYACTQVGCSQIQLGGSCFYPNTYLHHASFATNLYYQRMGRHEMDCNFANSGLISLSDPS |
Full Sequence |
---|
Protein Sequence Length: 118 Download |
MPKPTYTLPF LSLLLVHSFF NLGMPFIFHG CYIFVMVLQK IWCVVNPSTP HDELLANLDY 60 ACTQVGCSQI QLGGSCFYPN TYLHHASFAT NLYYQRMGRH EMDCNFANSG LISLSDPS 120 |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 4.0e-15 | 42 | 110 | 75 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 1.0e-28 | 42 | 118 | 78 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
RefSeq | XP_002275460.1 | 6e-23 | 30 | 118 | 23 | 111 | PREDICTED: hypothetical protein [Vitis vinifera] |
RefSeq | XP_002519703.1 | 5e-23 | 39 | 118 | 38 | 118 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
RefSeq | XP_002519722.1 | 8e-40 | 7 | 118 | 4 | 108 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 6e-17 | 40 | 118 | 132 | 210 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002528491.1 | 5e-24 | 39 | 118 | 31 | 110 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 3e-19 | 42 | 118 | 13 | 90 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |