| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_021708m |
| Family | AA2 |
| Protein Properties | Length: 144 Molecular Weight: 15555.5 Isoelectric Point: 9.5176 |
| Chromosome | Chromosome/Scaffold: 10042 Start: 226 End: 1282 |
| Description | Peroxidase superfamily protein |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| AA2 | 2 | 137 | 5.9e-24 |
| GGPSWVVPTGRKDGRISLVSEASAQLPSPFANIDQLKQHFAAKGLNVKDLVVLSGAHTIGIGRCSTLNNRLYNFTRKGDTDPSLDPAYAAELKTKCKPGD TNTVVDMDPGSSKLFDSNYYSVVARRRGMFQSDAAL | |||
| Full Sequence |
|---|
| Protein Sequence Length: 144 Download |
| VGGPSWVVPT GRKDGRISLV SEASAQLPSP FANIDQLKQH FAAKGLNVKD LVVLSGAHTI 60 GIGRCSTLNN RLYNFTRKGD TDPSLDPAYA AELKTKCKPG DTNTVVDMDP GSSKLFDSNY 120 YSVVARRRGM FQSDAALPND IQTR 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| cd00314 | plant_peroxidase_like | 4.0e-8 | 1 | 126 | 139 | + Heme-dependent peroxidases similar to plant peroxidases. Along with animal peroxidases, these enzymes belong to a group of peroxidases containing a heme prosthetic group (ferriprotoporphyrin IX), which catalyzes a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. The plant peroxidase-like superfamily is found in all three kingdoms of life and carries out a variety of biosynthetic and degradative functions. Several sub-families can be identified. Class I includes intracellular peroxidases present in fungi, plants, archaea and bacteria, called catalase-peroxidases, that can exhibit both catalase and broad-spectrum peroxidase activities depending on the steady-state concentration of hydrogen peroxide. Catalase-peroxidases are typically comprised of two homologous domains that probably arose via a single gene duplication event. Class II includes ligninase and other extracellular fungal peroxidases, while class III is comprised of classic extracellular plant peroxidases, like horseradish peroxidase. | ||
| pfam00141 | peroxidase | 1.0e-20 | 2 | 60 | 59 | + Peroxidase. | ||
| PLN03030 | PLN03030 | 2.0e-39 | 3 | 144 | 144 | + cationic peroxidase; Provisional | ||
| cd00693 | secretory_peroxidase | 6.0e-69 | 1 | 144 | 145 | + Horseradish peroxidase and related secretory plant peroxidases. Secretory peroxidases belong to class III of the plant heme-dependent peroxidase superfamily. All members of the superfamily share a heme prosthetic group and catalyze a multistep oxidative reaction involving hydrogen peroxide as the electron acceptor. Class III peroxidases are found in the extracellular space or in the vacuole in plants where they have been implicated in hydrogen peroxide detoxification, auxin catabolism and lignin biosynthesis, and stress response. Class III peroxidases contain four conserved disulphide bridges and two conserved calcium binding sites. | ||
| Gene Ontology | |
|---|---|
| GO Term | Description |
| GO:0004601 | peroxidase activity |
| GO:0006979 | response to oxidative stress |
| GO:0020037 | heme binding |
| GO:0055114 | oxidation-reduction process |
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| RefSeq | XP_002274157.1 | 0 | 1 | 144 | 137 | 280 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002280216.1 | 0 | 1 | 143 | 138 | 280 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002309830.1 | 0 | 1 | 144 | 138 | 281 | predicted protein [Populus trichocarpa] |
| RefSeq | XP_002527239.1 | 0 | 1 | 143 | 138 | 280 | Peroxidase 27 precursor, putative [Ricinus communis] |
| RefSeq | XP_002529736.1 | 0 | 1 | 143 | 138 | 281 | Peroxidase 27 precursor, putative [Ricinus communis] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 3hdl_A | 3e-33 | 2 | 137 | 113 | 251 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1qo4_A | 1e-30 | 2 | 137 | 114 | 250 | A Chain A, Crystal Structure Of Highly Glycosylated Peroxidase From Royal Palm Tree |
| PDB | 1pa2_A | 1e-30 | 2 | 137 | 114 | 250 | A Chain A, Arabidopsis Thaliana Peroxidase A2 |
| PDB | 3atj_B | 5e-30 | 2 | 137 | 114 | 251 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| PDB | 3atj_A | 5e-30 | 2 | 137 | 114 | 251 | A Chain A, Heme Ligand Mutant Of Recombinant Horseradish Peroxidase In Complex With Benzhydroxamic Acid |
| Metabolic Pathways | |||
|---|---|---|---|
| Pathway Name | Reaction | EC | Protein Name |
| betanidin degradation | RXN-8635 | EC-1.11.1.7 | peroxidase |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| CO478187 | 137 | 1 | 137 | 0 |
| EX309367 | 137 | 1 | 137 | 0 |
| EX309154 | 137 | 1 | 137 | 0 |
| GR038232 | 144 | 1 | 144 | 0 |
| CO161405 | 137 | 1 | 137 | 0 |
| Orthologous Group | |||||
|---|---|---|---|---|---|
| Species | ID | ||||
| Malus domestica | MDP0000692824 | MDP0000276635 | MDP0000187332 | ||
| Mimulus guttatus | mgv1a018192m | ||||
| Picea abies | MA_5149g0010 | MA_444g0010.156.332 | MA_444g0010.156.332 | MA_25748g0010 | MA_589770g0010 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |