y PlantCAZyme

CAZyme Information

Basic Information
SpeciesManihot esculenta
Cazyme IDcassava4.1_021940m
FamilyGT37
Protein PropertiesLength: 539 Molecular Weight: 61812.5 Isoelectric Point: 6.9045
ChromosomeChromosome/Scaffold: 10504 Start: 1448 End: 3064
Descriptionfucosyltransferase 1
View CDS
External Links
Plaza
CAZyDB
Signature Domain  Download full data set without filtering
FamilyStartEndEvalue
GT37675080
  GVNNLLGGLLPSGFDHESCLSRYQSVQYRKPSTKKPSPYLLSKLRNYENLHKRCGPYTKSYNETLNLLEPSNISSPSDCKYMVWKAQAGLGNRILTMAAA
  FLYAILTNRVLLVEHESDMVDLFCEPFPNTSWLLPLDFPLKNEFRKLNQMYPRTFGNMLKNNIINASTDLPPSFVYLFLAFRNDHYDKLFYCEEHQALLQ
  KVPWLIVKSDEYFIPSFFLMPSFEQELDKMFPDKETVFHHLGRYLFHPSNKAWGLITRFYQSHLAKADERIGIQIRVFDPKSSSFEIVMDQILACTLKEN
  LLPEVDKERFITSPSKNQTSKAILITSLHPEFYENMRDMYWTFPTLSGEVIGVYQPSHEQHQQFGDGMHNMKAWVEMYLLSLSDFLVTSSWSTFGYVAQG
  LGGLKPWILYKPEQQVIPNPACRRAMSMEPCFHLPPTYDCKA
Full Sequence
Protein Sequence     Length: 539     Download
MEVKPVNKVL GFGMVRTLTL VACLVAFPTL IMLSVIYQVG MLNLPEEFDK VNILEGIAQN    60
AAHFDVGVNN LLGGLLPSGF DHESCLSRYQ SVQYRKPSTK KPSPYLLSKL RNYENLHKRC    120
GPYTKSYNET LNLLEPSNIS SPSDCKYMVW KAQAGLGNRI LTMAAAFLYA ILTNRVLLVE    180
HESDMVDLFC EPFPNTSWLL PLDFPLKNEF RKLNQMYPRT FGNMLKNNII NASTDLPPSF    240
VYLFLAFRND HYDKLFYCEE HQALLQKVPW LIVKSDEYFI PSFFLMPSFE QELDKMFPDK    300
ETVFHHLGRY LFHPSNKAWG LITRFYQSHL AKADERIGIQ IRVFDPKSSS FEIVMDQILA    360
CTLKENLLPE VDKERFITSP SKNQTSKAIL ITSLHPEFYE NMRDMYWTFP TLSGEVIGVY    420
QPSHEQHQQF GDGMHNMKAW VEMYLLSLSD FLVTSSWSTF GYVAQGLGGL KPWILYKPEQ    480
QVIPNPACRR AMSMEPCFHL PPTYDCKAKM EVDMGTVVPY VKYCEDATSG LKLVNNNL*     540
Functional Domains Download unfiltered results here
Cdd IDDomainE-ValueStartEndLengthDomain Description
cd11548NodZ_like1.0e-10149469325+
pfam03254XG_FTase078508433+
Gene Ontology
GO TermDescription
GO:0008107galactoside 2-alpha-L-fucosyltransferase activity
GO:0016020membrane
GO:0042546cell wall biogenesis
Annotations - NR Download unfiltered results here
SourceHit IDE-ValueQuery StartQuery EndHit StartHit EndDescription
RefSeqXP_002297719.10105369551glycosyl transferase family 37 [Populus trichocarpa]
RefSeqXP_002304815.106553712486glycosyltransferase family-37 [Populus trichocarpa]
RefSeqXP_002304817.101153510552glycosyltransferase family-37 [Populus trichocarpa]
RefSeqXP_002527236.1015351539Galactoside 2-alpha-L-fucosyltransferase, putative [Ricinus communis]
RefSeqXP_002527238.103453635546Galactoside 2-alpha-L-fucosyltransferase, putative [Ricinus communis]
Transmembrane Domains
StartEnd
2042
Hydropathy
EST Download unfiltered results here
HitLengthStartEndEValue
DT7518203082285340
CV2884053082005070
DR9393012652705340
GT0436383071544600
GT043638204604793.7
Orthologous Group
SpeciesID
Aquilegia coeruleaAquca_002_00710.1Aquca_002_00674.2Aquca_002_00674.1Aquca_002_00675.1Aquca_002_00677.1
Aquca_024_00009.1Aquca_006_00124.1Aquca_002_00676.1.65.313Aquca_002_00676.1.65.313Aquca_002_00676.1.313.480
Aquca_002_00676.1.313.480
Arabidopsis lyrata484227312409.55.508312409.55.508484226879690
874761480406877549879689
Arabidopsis thalianaAT2G03220.1AT1G14100.1AT2G03210.1AT1G14070.1AT1G14080.1
AT2G15370.1AT2G15390.2AT2G15390.1AT1G74420.2AT1G74420.1
AT2G15350.1AT1G14110.1.33.335AT1G14110.1.33.335AT1G14110.1.336.446AT1G14110.1.336.446
Brachypodium distachyonBradi3g58030.1Bradi1g46010.1Bradi1g46020.1Bradi3g58040.1Bradi4g32407.1
Bradi2g40470.1Bradi3g58067.1Bradi1g46050.1Bradi1g46030.1Bradi5g11770.1
Bradi1g46037.1Bradi4g32160.1Bradi1g46002.1Bradi4g13697.1Bradi3g10230.1
Bradi3g58050.1
Brassica rapaBra024785Bra019679Bra019680Bra024786Bra016712
Bra016709Bra026858Bra026859Bra019685Bra016711
Bra015217Bra026861.214.659Bra026861.214.659Bra039838Bra019681
Bra019683.173.573Bra019683.173.573Bra026860Bra003802.296.542Bra003802.296.542
Bra016710.192.381Bra016710.192.381Bra016710.35.189Bra016710.35.189Bra003802.141.280
Bra003802.141.280Bra026861.47.184Bra026861.47.184Bra019683.64.173Bra019683.64.173
Carica papayaevm.model.supercontig_341.1evm.model.supercontig_1.58evm.model.supercontig_57.37
Capsella rubellaCarubv10016945mCarubv10008772mCarubv10011805m.34.489Carubv10011805m.34.489Carubv10011805m.34.489
Carubv10016438mCarubv10019159mCarubv10013337mCarubv10008907mCarubv10011805m.506.770
Carubv10011805m.506.770Carubv10011805m.506.770Carubv10020557mCarubv10011805m.771.920Carubv10011805m.771.920
Carubv10011805m.771.920
Citrus clementinaCiclev10000822mCiclev10000784mCiclev10019479mCiclev10000769mCiclev10033742m.202.352
Ciclev10033742m.202.352Ciclev10033742m.82.202Ciclev10033742m.82.202Ciclev10003626m.196.297Ciclev10003626m.196.297
Citrus sinensisorange1.1g009398morange1.1g009137morange1.1g039620morange1.1g008917morange1.1g010030m
orange1.1g019688morange1.1g046759m.200.367orange1.1g046759m.200.367orange1.1g046759m.82.201orange1.1g046759m.82.201
Cucumis sativusCucsa.284850.1Cucsa.112900.1Cucsa.179880.1
Eucalyptus grandisEucgr.B03204.1Eucgr.B00531.2Eucgr.B00531.1
Fragaria vescamrna26047.1-v1.0-hybrid
Glycine maxGlyma06g21090.1Glyma04g33170.1Glyma05g00920.1Glyma13g44770.9Glyma13g44770.8
Glyma13g44770.7Glyma13g44770.6Glyma13g44770.5Glyma13g44770.4Glyma13g44770.11
Glyma13g44770.10Glyma08g23480.1Glyma13g44770.15Glyma13g44770.14Glyma13g44770.13
Glyma13g44770.12Glyma07g02550.2Glyma07g02540.2Glyma07g02540.1Glyma17g10980.1
Glyma13g44760.1Glyma08g23470.2
Gossypium raimondiiGorai.013G088600.1Gorai.001G072600.2Gorai.001G072600.1
Linum usitatissimumLus10036776Lus10008696Lus10041642Lus10041641Lus10029049
Lus10037152Lus10026128Lus10024076Lus10041644Lus10013549
Lus10012571Lus10041645Lus10008693Lus10026125Lus10008691
Lus10024077Lus10024079
Malus domesticaMDP0000230681MDP0000176324MDP0000529420MDP0000204702MDP0000668674
MDP0000300083
Manihot esculentacassava4.1_023646mcassava4.1_025117mcassava4.1_004330mcassava4.1_004355mcassava4.1_004412m
cassava4.1_004549mcassava4.1_004338m
Medicago truncatulaMedtr1g090430.1AC233556_13.1Medtr4g007220.1Medtr2g020730.1Medtr4g007380.1
Medtr4g007360.1
Mimulus guttatusmgv1a003737m
Oryza sativaLOC_Os02g52640.1LOC_Os02g52610.1LOC_Os02g52610.2LOC_Os06g10960.1LOC_Os02g52630.1
LOC_Os06g10950.1LOC_Os06g10970.1LOC_Os02g52560.1LOC_Os04g37640.1LOC_Os04g37650.1
LOC_Os06g10930.1LOC_Os02g52590.1LOC_Os06g10980.1LOC_Os06g10910.1LOC_Os09g28460.1
LOC_Os08g24750.1LOC_Os06g10920.1LOC_Os02g17534.1LOC_Os02g17600.1LOC_Os02g25630.1
Panicum virgatumPavirv00070548mPavirv00051908mPavirv00022554mPavirv00065240mPavirv00003029m
Pavirv00050380mPavirv00010182mPavirv00042819mPavirv00022553mPavirv00056797m
Pavirv00051909mPavirv00044824mPavirv00015944mPavirv00041002mPavirv00051213m
Pavirv00040276mPavirv00068125mPavirv00007429mPavirv00000679mPavirv00064479m
Pavirv00019978mPavirv00015945mPavirv00061706mPavirv00010181mPavirv00034186m
Pavirv00004957mPavirv00041951mPavirv00007564mPavirv00053047mPavirv00026147m.124.422
Pavirv00026147m.124.422Pavirv00026388m
Physcomitrella patensPp1s352_42V6.1Pp1s126_53V6.1Pp1s177_107V6.1Pp1s177_109V6.1Pp1s38_405V6.1
Pp1s28_329V6.1Pp1s92_101V6.1Pp1s52_48V6.1Pp1s75_26V6.1Pp1s115_139V6.1
Pp1s115_139V6.2Pp1s199_19V6.1.228.510Pp1s199_19V6.1.228.510Pp1s71_58V6.1Pp1s199_19V6.1.107.211
Pp1s199_19V6.1.107.211
Phaseolus vulgarisPhvul.009G185700.1Phvul.005G182600.1Phvul.010G162100.1Phvul.010G162000.1Phvul.010G161900.1
Phvul.010G161900.2Phvul.003G188900.1
Picea abiesMA_38751g0010MA_478295g0010MA_402760g0010
Populus trichocarpaPotri.001G034100.1Potri.003G191200.1Potri.003G191500.1Potri.003G191300.2Potri.001G033800.1
Potri.008G090000.1Potri.003G191300.1Potri.003G191300.3Potri.003G191300.4Potri.001G034000.1
Prunus persicappa003476mppa003874m
Ricinus communis28333.m00057928333.m00058129686.m00087429686.m00087629813.m001528
29686.m00087529686.m00087730138.m004050.273.51930138.m004050.273.51928333.m000580
30138.m004050.89.27530138.m004050.89.275
Setaria italicaSi019396mSi016945mSi008446mSi008440mSi016741m
Si006115mSi019763mSi007978mSi008778mSi019585m
Si008425mSi012369mSi012302mSi009710mSi007932m
Si031974mSi008742mSi029404mSi016775mSi029293m
Si017473m
Selaginella moellendorffii9176197987416793441628412985
444560430640.63.271430640.63.271430640.280.409430640.280.409
427741.233.362427741.233.362427741.63.183427741.63.183420100
Sorghum bicolorSb04g034120.1Sb04g034100.1Sb10g007140.1Sb04g034070.1Sb10g007120.1
Sb04g034110.1Sb04g034080.1Sb02g026640.1Sb04g010430.1Sb10g007110.1
Sb04g010420.1Sb06g018250.1Sb04g010630.1Sb10g007150.1Sb02g001790.1
Sb08g004580.1Sb02g001803.1Sb10g007130.1.70.296Sb10g007130.1.70.296Sb10g007130.1.329.513
Sb10g007130.1.329.513
Thellungiella halophilaThhalv10003931mThhalv10009330mThhalv10009872mThhalv10007297mThhalv10009357m
Thhalv10009946mThhalv10009405mThhalv10005557mThhalv10022636mThhalv10009670m
Thhalv10018409mThhalv10000629m
Vitis viniferaGSVIVT01003228001.70.337GSVIVT01003228001.70.337GSVIVT01007978001.81.321GSVIVT01007978001.81.321GSVIVT01007978001.323.487
GSVIVT01007978001.323.487GSVIVT01003228001.337.442GSVIVT01003228001.337.442
Sequence Alignments  (This image is cropped. Click for full image.)
Phylogeny  (This image is cropped. Click for full image.)