Basic Information | |
---|---|
Species | Manihot esculenta |
Cazyme ID | cassava4.1_022539m |
Family | CBM43 |
Protein Properties | Length: 106 Molecular Weight: 12018.4 Isoelectric Point: 6.4887 |
Chromosome | Chromosome/Scaffold: 03859 Start: 526455 End: 527014 |
Description | Carbohydrate-binding X8 domain superfamily protein |
View CDS |
Signature Domain Download full data set without filtering | |||
---|---|---|---|
Family | Start | End | Evalue |
CBM43 | 7 | 87 | 3.6e-30 |
WCIVNPSTTHSELLVNLDYACSHVRCSQIQQGSSCFYPNTYHHHASFAMNLYYQFMGRHEEDCNFTNSALISLSDPSSGSC |
Full Sequence |
---|
Protein Sequence Length: 106 Download |
MLLQKTWCIV NPSTTHSELL VNLDYACSHV RCSQIQQGSS CFYPNTYHHH ASFAMNLYYQ 60 FMGRHEEDCN FTNSALISLS DPSSGSCIYE SGGNLEAYGK PYNKTY |
Functional Domains Download unfiltered results here | ||||||||
---|---|---|---|---|---|---|---|---|
Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
pfam07983 | X8 | 7.0e-14 | 6 | 75 | 76 | + X8 domain. The X8 domain domain contains at least 6 conserved cysteine residues that presumably form three disulphide bridges. The domain is found in an Olive pollen allergen as well as at the C-terminus of several families of glycosyl hydrolases. This domain may be involved in carbohydrate binding. This domain is characteristic of GPI-anchored domains. | ||
smart00768 | X8 | 2.0e-30 | 6 | 89 | 85 | + Possibly involved in carbohydrate binding. The X8 domain, which may be involved in carbohydrate binding, is found in an Olive pollen antigen as well as at the C terminus of family 17 glycosyl hydrolases. It contains 6 conserved cysteine residues which presumably form three disulfide bridges. |
Annotations - NR Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
GenBank | ACG39487.1 | 7e-27 | 4 | 89 | 36 | 121 | glucan endo-1,3-beta-glucosidase 4 precursor [Zea mays] |
RefSeq | XP_002300444.1 | 6e-27 | 4 | 89 | 29 | 114 | predicted protein [Populus trichocarpa] |
RefSeq | XP_002519722.1 | 5.99756e-43 | 4 | 105 | 29 | 130 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002519722.1 | 8e-20 | 5 | 89 | 132 | 216 | hypothetical protein RCOM_0633850 [Ricinus communis] |
RefSeq | XP_002528491.1 | 1e-27 | 4 | 89 | 31 | 116 | hydrolase, hydrolyzing O-glycosyl compounds, putative [Ricinus communis] |
Annotations - PDB Download unfiltered results here | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
PDB | 2jon_A | 7e-23 | 6 | 94 | 12 | 101 | A Chain A, Solution Structure Of The C-Terminal Domain Ole E 9 |
EST Download unfiltered results here | ||||
---|---|---|---|---|
Hit | Length | Start | End | EValue |
EE255611 | 102 | 4 | 105 | 4.99983e-42 |
EY745502 | 92 | 4 | 95 | 6e-34 |
FQ362276 | 86 | 4 | 89 | 1e-27 |
EE255611 | 85 | 5 | 89 | 2e-19 |
EY745502 | 67 | 5 | 71 | 0.0000000002 |
Sequence Alignments (This image is cropped. Click for full image.) |
---|