| Basic Information | |
|---|---|
| Species | Manihot esculenta |
| Cazyme ID | cassava4.1_023209m |
| Family | GH17 |
| Protein Properties | Length: 124 Molecular Weight: 13050.8 Isoelectric Point: 4.6324 |
| Chromosome | Chromosome/Scaffold: 09692 Start: 182421 End: 182829 |
| Description | beta-1,3-glucanase 3 |
| View CDS | |
| Signature Domain Download full data set without filtering | |||
|---|---|---|---|
| Family | Start | End | Evalue |
| GH17 | 9 | 120 | 4.9e-30 |
| LGVCYGMLGNLPPLAEVISLCNQNSIRMRLYDPNQDALQALGGSDIELILGLPNDKLQNIASSQAEADSWFRYFAVGNEVKPSAAEANSPVPAMRNILNA LNSAGLGSIKVS | |||
| Full Sequence |
|---|
| Protein Sequence Length: 124 Download |
| VNSNTGAQLG VCYGMLGNLP PLAEVISLCN QNSIRMRLYD PNQDALQALG GSDIELILGL 60 PNDKLQNIAS SQAEADSWFR YFAVGNEVKP SAAEANSPVP AMRNILNALN SAGLGSIKVS 120 KNY* 180 |
| Functional Domains Download unfiltered results here | ||||||||
|---|---|---|---|---|---|---|---|---|
| Cdd ID | Domain | E-Value | Start | End | Length | Domain Description | ||
| pfam00332 | Glyco_hydro_17 | 1.0e-38 | 9 | 121 | 129 | + Glycosyl hydrolases family 17. | ||
| Annotations - NR Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| GenBank | AAF33405.1 | 9.99967e-42 | 5 | 120 | 30 | 158 | AF230109_1 beta-1,3 glucanase [Populus tremula x Populus alba] |
| GenBank | ABK58141.1 | 0 | 12 | 120 | 1 | 122 | beta-1,3-glucanase [Manihot esculenta] |
| EMBL | CBI30053.1 | 7.00649e-43 | 5 | 121 | 18 | 149 | unnamed protein product [Vitis vinifera] |
| RefSeq | XP_002277827.1 | 9.99967e-42 | 5 | 120 | 31 | 161 | PREDICTED: hypothetical protein [Vitis vinifera] |
| RefSeq | XP_002308018.1 | 2.94273e-44 | 6 | 121 | 31 | 159 | predicted protein [Populus trichocarpa] |
| Annotations - PDB Download unfiltered results here | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-Value | Query Start | Query End | Hit Start | Hit End | Description |
| PDB | 2cyg_A | 2e-30 | 9 | 121 | 1 | 129 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_D | 2e-29 | 8 | 120 | 1 | 132 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_C | 2e-29 | 8 | 120 | 1 | 132 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_B | 2e-29 | 8 | 120 | 1 | 132 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| PDB | 3f55_A | 2e-29 | 8 | 120 | 1 | 132 | A Chain A, Crystal Structure At 1.45- Resolution Of The Major Allergen Endo-Beta-1,3-Glucanase Of Banana As A Molecular Basis For The Latex-Fruit Syndrome |
| Hydropathy |
|---|
 |
| EST Download unfiltered results here | ||||
|---|---|---|---|---|
| Hit | Length | Start | End | EValue |
| DB924368 | 129 | 5 | 120 | 0 |
| DV451904 | 129 | 5 | 120 | 0 |
| BU826617 | 129 | 5 | 120 | 0 |
| DY801705 | 129 | 5 | 120 | 0 |
| DT473628 | 127 | 7 | 120 | 0 |
| Sequence Alignments (This image is cropped. Click for full image.) |
|---|
 |
| Phylogeny |
|---|
 |